Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR682 IGR681 IGR683 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 pckA, - CPn0851 CPn0852 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 pckA, - CPn0851 CPn0852 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0853 pckA, - CPn0851 CPn0852
* Calculated from Protein Sequence

Gene ID: CPn0854

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ompB  

Definition:
major outer membrane protein (MOMP)

Gene Start:
972837

Gene Stop:
971803

Gene Length:
1035

Molecular Weight*:
37720

pI*:
6.30

Net Charge*:
-1.56

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
This protein is thought to confer structural rigidity of the EB and to serve as a porin for the RB.

Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT713, a predicted major outer membrane protein (MOMP) sequence. Residues 1-344 are 59% similar to CT713.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 9-58, 63-92, 177-231, and 233-277 represent blocks PF01308A,B,D,E (Chlamydia major outer membrane protein) with a combined E-value of 5.3e-07.

ProDom Summary:  Protein Domain Search
Residues 18-229 are 24% similar to a defined domain of OMP3_CHLPS, defined as: OUTER MEMBRANE MAJOR PROTEIN PRECURSOR SIGNAL MOMP PORIN TRANSMEMBRANE SEROVAR.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
30
non-globular  
76  
153

PDB Hit:


Gene Protein Sequence:
MNSKMLKHLRLATLSFSMFFGIVSSPAVYALGAGNPAAPVLPGVNPEQTG
WCAFQLCNSYDLFAALAGSLKFGFYGDYVFSESAHITNVPVITSVTTSGT
GTTPTITSTTKNVDFDLNNSSISSSCVFATIALQETSPAAIPLLDIAFTA
RVGGLKQYYRLPLNAYRDFTSNPLNAESEVTDGLIEVQSDYGIVWGLSLQ
KVLWKDGVSFVGVSADYRHGSSPINYIIVYNKANPEIYFDATDGNLSYKE
WSASIGISTYLNDYVLPYASVSIGNTSRKAPSDSFTELEKQFTNFKFKIR
KITNFDRVNFCFGTTCCISNNFYYSVEGRWGYQRAINITSGLQF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGCAAGATGCTAAAACATTTACGTTTAGCAACCCTTTCCTTCTC
TATGTTCTTCGGGATTGTATCTTCTCCCGCAGTATATGCCCTAGGGGCTG
GAAACCCTGCAGCTCCAGTACTCCCAGGTGTGAATCCTGAGCAAACGGGA
TGGTGTGCCTTCCAACTTTGTAATAGTTACGATCTTTTTGCTGCTCTTGC
AGGAAGCCTCAAATTTGGGTTCTATGGAGATTATGTCTTCTCAGAAAGTG
CCCATATTACCAATGTCCCTGTCATTACCTCCGTTACGACTTCAGGCACA
GGAACAACGCCAACCATTACCTCTACAACTAAAAACGTAGACTTTGATCT
TAACAACAGCTCCATCAGCTCGAGCTGTGTTTTTGCAACCATAGCTCTAC
AGGAAACATCCCCAGCTGCCATTCCCCTTTTAGATATAGCCTTCACTGCA
CGTGTCGGAGGACTTAAGCAGTACTACCGCCTCCCTCTCAATGCTTACAG
AGACTTCACTTCAAATCCTTTAAATGCAGAATCTGAAGTTACAGATGGTC
TCATTGAAGTCCAGTCAGACTATGGAATTGTCTGGGGTCTGAGTTTACAA
AAAGTATTGTGGAAAGATGGAGTGTCTTTTGTAGGGGTGAGCGCTGACTA
CCGTCACGGTTCCAGTCCCATCAACTATATCATCGTTTACAACAAGGCCA
ACCCCGAGATCTATTTCGATGCTACTGATGGAAACCTAAGCTATAAAGAA
TGGTCTGCAAGCATCGGCATCTCTACGTATCTTAATGACTATGTGCTTCC
CTATGCATCCGTATCTATAGGAAATACTTCAAGAAAAGCTCCTTCTGATA
GCTTCACAGAACTCGAAAAGCAATTTACGAATTTTAAATTTAAAATTCGT
AAAATCACAAACTTCGACAGAGTAAACTTCTGCTTCGGAACTACCTGCTG
CATCTCAAATAACTTCTACTATAGTGTAGAAGGCCGTTGGGGATATCAGC
GTGCTATCAACATTACGTCAGGTCTGCAGTTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy