Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR680 IGR684 IGR682 IGR681 IGR683 ompB, - CPn0854 fliI, - CPn0858 CPn0856 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 ompB, - CPn0854 fliI, - CPn0858 CPn0856 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0857 gpdA  gpsA, - CPn0855 gpdA  gpsA, - CPn0855 CPn0857 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852
* Calculated from Protein Sequence

Gene ID: CPn0853

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
970637

Gene Stop:
971806

Gene Length:
1170

Molecular Weight*:
42513

pI*:
6.00

Net Charge*:
-3.59

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0853 is orthologously related to CT712: residues 2-385 of CPn0853 are 48% similar to residues 4-389 of CT712, a predcted Chlamydia-specific hypothetical protein from C. trachomatis.
CPn0853 is also similar to CT711, CT621, CT619, CT620, all predicted Chlamydia-specific hypothetical proteins from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Three possible paralogs found in C.pneumoniae, all of which are hypothetical protein sequences. Residues 131-389 are 27% similar to CPn0852; residues 132-379 are 31% similar to CPn0727; and residues 130-383 are 28% similar to CPn0726.

Pfam Summary:  Pfam Search
Residues 3 to 386 (E-value = 4.8e-189) place CPn0853 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

PDB Hit:


Gene Protein Sequence:
MHPKIEKRNSLPLTAVAPVFEESYHPSVATTVDYVDATTLSRHLTVLKDV
IKEARNLDLGKAFLTSMKQGFINTGTELAIIQASLADQSSRESRKKEEKI
FHQHLGKAAPQAATATSGVQPTADPVADKMPLQSAFAYVLLDKYIPAQEE
ALYALGRELNLSGYAQNLFSPLLDMIKSFNSAPINYNLGSYISQTSGTAN
FAYGYEMILSRYNNEVSQCRLDIASTVKAKAALANMSASVKANVSLTDAQ
KKQIEDIIASYTKSLDVIHTQLTDVMTNLASITFVPGLNKYDPSYRIVGG
DLSIIALQNDEKVLVDGKVDITTAVNEGGLLNFFTTVLTDVQNYGDLAQT
QQLMLDLELKAMQQQWSLVSASLKLLNGMYTTVISGFKN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCCGAAAATAGAAAAAAGAAATAGCCTTCCACTTACGGCAGTCGC
TCCTGTGTTTGAAGAATCGTATCATCCTTCTGTAGCTACAACTGTAGATT
ATGTAGATGCCACGACACTTTCCCGACATCTTACAGTCTTAAAAGATGTG
ATAAAAGAAGCTCGAAACTTAGATTTAGGGAAGGCATTCCTGACATCTAT
GAAACAGGGTTTTATAAATACGGGTACGGAACTTGCCATTATACAAGCAT
CTCTGGCAGATCAGAGTAGTCGCGAGTCGCGTAAGAAGGAAGAGAAGATC
TTCCATCAGCACTTAGGAAAGGCAGCCCCACAAGCGGCAACAGCAACTTC
AGGAGTGCAGCCTACTGCGGATCCTGTTGCTGATAAGATGCCTTTACAAT
CTGCATTTGCCTATGTTCTCCTTGATAAGTACATTCCTGCTCAAGAGGAA
GCCCTTTATGCTCTTGGAAGGGAGTTAAACCTATCAGGATATGCGCAAAA
TTTATTTAGTCCTCTTTTAGATATGATTAAGAGCTTTAACTCTGCTCCTA
TCAACTACAATTTAGGATCGTACATATCTCAGACGAGTGGCACTGCGAAT
TTCGCGTATGGTTATGAGATGATTTTATCGCGCTATAACAACGAAGTCTC
TCAATGTCGCCTGGACATAGCAAGTACAGTAAAAGCTAAAGCTGCGTTAG
CGAACATGTCGGCTTCTGTTAAAGCAAATGTGAGTCTGACTGATGCACAG
AAGAAACAAATTGAGGATATCATTGCCAGCTATACGAAATCTTTAGATGT
GATTCATACACAGTTAACTGATGTGATGACAAATTTAGCATCCATAACCT
TTGTTCCTGGTTTAAATAAATATGATCCTTCGTATCGCATTGTTGGTGGG
GATTTATCTATCATTGCCTTGCAGAATGACGAGAAGGTACTTGTCGATGG
TAAGGTGGATATCACGACTGCTGTGAATGAAGGAGGCCTACTTAATTTCT
TCACTACAGTCCTTACGGATGTGCAGAATTATGGAGACTTAGCTCAAACG
CAACAGCTGATGTTGGACTTAGAGCTTAAGGCGATGCAACAACAATGGAG
TTTAGTATCTGCATCTTTGAAATTATTGAATGGGATGTATACCACAGTAA
TTTCTGGATTTAAAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy