Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR680 IGR679 IGR682 IGR681 IGR683 ompB, - CPn0854 CPn0856 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 ompB, - CPn0854 CPn0856 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 ompB, - CPn0854 gpdA  gpsA, - CPn0855 CPn0856 gpdA  gpsA, - CPn0855 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0852

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
968316

Gene Stop:
970616

Gene Length:
2301

Molecular Weight*:
84967

pI*:
4.70

Net Charge*:
-16.46

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0852 is orthologously related to CT711: residues 1-765 of CPn0852 are 39% similar to residues 1-767 of CT711, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.
CPn0852 is also similar to CT619, CT620, CT621, CT712. No significant similarity to T. pallidum, M. genitalium, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Residues 376-766 are 26% similar to CPn0727; residues 280-764 are 22% similar to CPn0726; and residues 506-766 are 27% similar to Cpn0853.

Pfam Summary:  Pfam Search
Residues 374 to 763 (E-value = 7.6e-196) place CPn0852 in the DUF582 family which is described as Protein of unknown function, DUF582 (PF04518)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
618  
645
non-globular  
686  
766

PDB Hit:


Gene Protein Sequence:
VTLQPSYINFTPNVTTALSGGKIDTSAIELSCSALFFQELQDKAQGLKHA
LGLVQELSAEALRPAQVQTSISYLPTEESSRPGISAGIIDRTMPTFTDDE
VKAILQNPNFETSKIFVEGLDKVFKSYLDSVTPPEGIDPSNPESAIILNY
ITLLNNLKPKFAAGSTPTDADYNALYALPGDFVKEIEALKAADAPPKSKV
HAFWQEIMTIYNNMQVLSYPVTDYLNVQIADLSLNITAAQEVQQYLKNFY
SILKDILNPGWTDPQATHYPADAEYNARDAGVIQSLLNLSGNYRQLTENM
LPNTDTSLPQEIIAQIRSFQNGVNGTIIASNTLLPTTMRLDTLLGVIYTY
QCCATIFGMSYGTSTPAKQNYIDAINQEKSYWQARANGFDVTSDQVFDQF
ATNIQSGTSYRGIDLFKNNKVNEINPIFLSQAASFLRYPYNLMSRSMYQT
IEDAANRSITALDGLISGWSTQIATFQTQKNSLDPSLLKYFDTMKANKES
FVTTAPLQMVYSSLMLDKYLPTQQNVIASLGIQMTYSNKAAKYLNELIKE
ITTFQSADIYYSLSIYLKQMNLQAVADPIGKAVGVLNDEKTRAMADITRC
NKIKAAIDKMLVEIKADAELSKSQIRELVDTLTNFKSQSDDLIRNLSCLL
GFLSGLTLKAVNDPNATYEAFTAEIFTEPFNNWKRQLATFESFVIQGGQN
GITPGGQQQLLQAMESSQQDFSTFNQNQQLALQLESSAMQQEWTLVSAAL
ALLNQMVSKIARRIKS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACGCTACAACCGAGCTACATTAATTTCACCCCCAATGTGACCACTGC
TTTATCTGGTGGTAAGATTGATACGTCAGCTATCGAACTTTCTTGCAGCG
CTCTATTTTTCCAAGAGTTGCAAGATAAAGCTCAGGGTTTAAAACATGCT
TTGGGTTTAGTTCAGGAGTTAAGTGCAGAGGCACTTCGTCCCGCCCAAGT
TCAAACCTCAATTTCCTATCTTCCTACAGAAGAATCCTCACGTCCAGGGA
TTTCTGCTGGAATCATAGATAGGACAATGCCGACCTTTACTGATGACGAG
GTAAAGGCTATCCTCCAAAACCCTAATTTTGAAACGTCTAAAATTTTCGT
TGAGGGCTTGGATAAGGTCTTCAAGAGTTATTTAGATTCTGTTACCCCTC
CCGAGGGTATAGATCCTTCGAATCCTGAGAGTGCTATTATACTTAACTAT
ATAACGCTCTTGAATAATCTTAAGCCTAAATTTGCTGCTGGTTCGACACC
AACAGACGCTGATTATAACGCTCTCTATGCGTTGCCTGGTGATTTTGTGA
AGGAAATCGAGGCTTTGAAAGCAGCGGATGCTCCTCCTAAAAGTAAGGTT
CATGCTTTTTGGCAGGAGATCATGACAATTTACAATAACATGCAGGTACT
TTCCTATCCTGTTACGGATTACCTTAATGTTCAGATTGCGGATCTTTCTC
TTAATATTACCGCTGCTCAGGAGGTCCAACAGTATCTAAAGAACTTTTAT
AGCATATTAAAGGACATTTTGAATCCAGGATGGACGGATCCACAGGCGAC
GCACTATCCAGCAGATGCAGAGTATAATGCTCGCGATGCTGGGGTGATTC
AAAGTTTATTAAATTTGAGTGGGAACTATCGTCAGCTGACTGAGAATATG
CTCCCCAATACAGATACAAGTCTTCCCCAGGAAATTATTGCTCAGATTCG
TAGTTTCCAAAATGGTGTGAATGGGACGATAATTGCATCCAACACTCTTC
TACCTACTACCATGAGACTCGATACTCTCCTTGGTGTTATCTATACCTAT
CAGTGTTGTGCCACTATTTTTGGAATGAGCTATGGAACTAGCACTCCGGC
TAAGCAAAATTACATAGATGCTATTAATCAAGAAAAAAGTTACTGGCAAG
CGCGAGCAAATGGATTTGATGTAACTAGTGATCAGGTTTTTGACCAATTT
GCTACTAATATACAGAGCGGCACTTCATATAGAGGCATAGATCTTTTCAA
AAATAATAAAGTAAACGAGATCAATCCTATTTTCTTAAGTCAGGCTGCAT
CTTTCTTACGGTATCCGTATAATTTGATGTCACGTAGTATGTATCAAACT
ATAGAGGATGCTGCTAATAGATCTATTACGGCTTTGGATGGGCTAATTTC
CGGTTGGAGTACACAGATAGCAACCTTCCAAACGCAGAAAAATTCTTTGG
ATCCTTCTTTGTTGAAGTATTTTGATACTATGAAAGCCAACAAAGAGTCT
TTTGTAACCACAGCTCCTTTGCAGATGGTCTACTCTTCATTGATGTTGGA
TAAGTATTTGCCTACGCAGCAGAACGTGATTGCCTCCTTAGGGATACAGA
TGACGTATTCTAATAAGGCTGCTAAGTATCTCAACGAACTAATCAAAGAG
ATCACTACGTTTCAATCTGCCGATATTTATTATTCTTTATCTATATATTT
GAAACAGATGAATTTGCAAGCGGTAGCGGATCCTATTGGTAAGGCTGTGG
GTGTTTTGAATGATGAAAAAACACGAGCGATGGCAGATATTACCCGCTGC
AATAAGATAAAAGCGGCTATTGATAAGATGCTCGTTGAGATCAAGGCGGA
TGCAGAGTTATCAAAGTCACAAATTCGTGAGCTTGTGGATACGTTAACAA
ACTTCAAGTCTCAAAGCGACGATCTGATTCGCAATTTATCTTGTTTACTG
GGTTTCTTATCAGGGCTCACCCTTAAAGCTGTGAATGACCCTAATGCTAC
GTATGAGGCATTTACTGCAGAAATCTTCACAGAACCTTTTAATAATTGGA
AACGGCAGTTAGCTACATTTGAGAGTTTTGTGATTCAAGGTGGGCAAAAT
GGAATTACCCCAGGTGGTCAGCAACAGCTCTTACAGGCTATGGAGTCTTC
ACAACAAGATTTTTCAACGTTTAACCAGAACCAACAGCTTGCTCTGCAAT
TAGAATCATCAGCAATGCAACAGGAATGGACTCTTGTAAGTGCTGCCCTT
GCTTTATTAAACCAAATGGTTTCGAAGATTGCGAGAAGGATTAAATCTTA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy