Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR680 IGR679 IGR682 IGR681 ompB, - CPn0854 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 ompB, - CPn0854 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 ompB, - CPn0854 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0851

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pckA  

Definition:
phosphoenolpyruvate carboxykinase

Gene Start:
966396

Gene Stop:
968198

Gene Length:
1803

Molecular Weight*:
66983

pI*:
5.60

Net Charge*:
-9.30

EC:
4.1.1.32  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Citrate cycle (TCA cycle)
Pyruvate metabolism

Comment:
This enzyme is functional in gluconeogenesis.

See the comment to CT708.

From Prosite PDOC00421:

Phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32) (PEPCK) catalyzes the formation of phosphoenolpyruvate by decarboxylation of oxaloacetate while hydrolyzing GTP, a rate limiting step in gluconeogenesis (the biosynthesis of glucose). In vertebrates there are two isozymes: a cytosolic form whose activity is affected by hormones regulating this metabolic process (such as glucagon, or insulin) and a mitochondrial form.

An essential cysteine residue has been proposed to be implicated in the catalytic mechanism; this residue is located in the central part of PEPCK and is in the center of a perfectly conserved region that we use as a signature pattern.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphoenolpyruvate carboxykinase sequences; e.g. residues 3-598 are 75% similar to CT710, predicted phosphoenolpyruvate carboxykinase; residues 7-590 are 53% similar to TP0122, a predicted phosphoenolpyruvate carboxykinase; residues 9-597 are 55% similar to (Z92669) pckA [Mycobacterium tuberculosis]; residues 5-598 are 54% similar to PPCK_NEOFR; and residues 9-600 are 52% similar to (Z95398) PckA [Mycobacterium leprae].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1274
COG name: Phosphoenolpyruvate carboxykinase
Functional Class:  C
The phylogenetic pattern of COG1274 is ---k------r------lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 58-522 span eleven regions of similarity to blocks BL00505A-K (Phosphoenolpyruvate carboxykinase (GTP) proteins) with a combined E-value of 5.1e-215.

ProDom Summary:  Protein Domain Search
Residues 76-598 are 55% similar to a defined domain of PPCK_NEOFR, defined as: PHOSPHOENOLPYRUVATE CARBOXYKINASE GTP CARBOXYLASE LYASE DECARBOXYLASE GTP-BINDING GLUCONEOGENESIS PEPCK CYTOSOLIC.
Residues 9-75 are 50% similar to a defined domain of P96393_MYCTU, defined as: PHOSPHOENOLPYRUVATE CARBOXYKINASE GTP CARBOXYLASE LYASE DECARBOXYLASE GTP-BINDING GLUCONEOGENESIS PEPCK CYTOSOLIC.

Paralogs:  Local Blast Search
None.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MVWSTNIKHEGLKSWIDEVAKLTTPKDIRLCDGSDTEYDELCTLMESTGT
MIRLNPEFHPNCFLVRSSADDVARVEQFTFICTSTEAEAGPTNNWRDPQE
MRRELHQLFRGCMQGRTLYIVPFCMGPLDSPFSIVGVELTDSPYVVCSMK
IMTRMGDDVLRSLGTSGKFLKCLHSVGKPLSPGEADVSWPCNPKSMRIVH
FQDDSSVMSFGSGYGGNALLGKKCVALRLASYMAKSQGWLAEHMLIIGIT
NPEGKKKYFSASFPSACGKTNLAMLMPKLPGWKIECIGDDIAWIRPGRDG
RLYAVNPEYGFFGVAPGTSERTNPNALATCRSNSIFTNVALTADGDVWWE
GLTEQPPEPLTDWLGKPWKPGGSPAAHPNSRFTAPLRQCPSLDPEWNSPQ
GVPLDAIIFGGRRSETIPLVYEALSWEHGVTIGAGMSSTTTAAIVGQLGK
LRHDPFAMLPFCGYNMAYYFQHWLSFAENRSLKLPKIFGVNWFRKNNQGE
FLWPGFSENLRVLEWIFQRTDGLEDIAERTPIGYLPNIQKFNLNGLNLDL
QTVQELFSVDAEGWLAEVENIGEYLKIFGSDCPQQITDELLRIKSELKEK
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTATGGAGCACCAACATCAAGCATGAAGGTCTGAAATCTTGGATTGA
TGAGGTTGCTAAATTAACGACTCCGAAGGACATACGTCTTTGTGATGGTT
CGGATACCGAGTATGATGAGCTCTGCACTCTTATGGAGAGTACAGGGACG
ATGATCCGTTTGAATCCTGAGTTTCATCCCAATTGCTTTTTGGTCCGTTC
GTCTGCTGATGATGTCGCTCGGGTAGAGCAATTTACTTTCATTTGCACTT
CGACGGAAGCAGAGGCAGGCCCTACGAATAATTGGAGAGATCCTCAAGAG
ATGCGTAGGGAGTTGCATCAACTTTTTCGTGGATGTATGCAGGGGCGCAC
TCTGTATATAGTTCCTTTCTGTATGGGTCCTTTAGACTCTCCATTTTCTA
TTGTAGGTGTTGAGTTAACAGATTCTCCTTATGTCGTTTGTTCTATGAAG
ATCATGACTCGTATGGGTGATGATGTTTTACGTTCTTTAGGGACTTCGGG
GAAGTTTTTAAAGTGTTTACATAGTGTGGGTAAGCCTTTATCTCCAGGAG
AGGCCGATGTTTCTTGGCCTTGCAATCCGAAATCAATGCGGATTGTACAT
TTTCAAGATGATAGTAGTGTGATGTCTTTTGGAAGTGGTTATGGAGGCAA
TGCTTTACTGGGTAAGAAGTGTGTGGCTCTTCGCTTAGCTTCTTACATGG
CAAAATCTCAGGGCTGGCTTGCTGAGCACATGTTGATTATTGGAATTACC
AATCCTGAAGGGAAGAAAAAATACTTTTCTGCTTCGTTCCCGAGTGCCTG
TGGTAAGACAAATTTAGCTATGTTGATGCCTAAACTTCCAGGTTGGAAGA
TTGAGTGTATTGGGGATGATATTGCTTGGATCCGTCCGGGTCGTGACGGC
AGGTTGTATGCTGTAAATCCAGAATATGGATTTTTTGGTGTTGCTCCTGG
GACTTCTGAGCGTACAAATCCCAATGCTTTGGCAACTTGCAGGTCGAATT
CTATTTTTACGAATGTTGCCTTGACTGCCGATGGGGATGTTTGGTGGGAG
GGATTAACGGAGCAACCACCAGAGCCTTTAACAGATTGGCTTGGAAAGCC
TTGGAAGCCTGGAGGGAGTCCTGCTGCCCATCCGAATTCTCGATTTACAG
CTCCTTTACGTCAGTGTCCTTCTTTAGATCCTGAGTGGAATAGTCCTCAG
GGTGTTCCCTTAGATGCTATTATTTTTGGCGGACGTCGTTCCGAAACCAT
TCCTTTAGTTTACGAAGCTTTAAGTTGGGAACACGGAGTGACTATAGGAG
CGGGGATGTCATCGACGACAACTGCAGCTATTGTTGGTCAGTTAGGTAAA
CTCCGCCACGATCCTTTTGCCATGCTTCCTTTCTGTGGGTATAACATGGC
ATATTACTTCCAGCATTGGCTTTCCTTTGCTGAGAATAGAAGTCTTAAGC
TTCCTAAGATTTTTGGAGTCAATTGGTTCCGTAAGAATAATCAAGGGGAG
TTTCTCTGGCCTGGTTTTAGTGAAAACTTACGTGTTCTAGAATGGATATT
CCAAAGGACTGATGGTCTGGAAGATATTGCAGAGCGCACGCCTATTGGTT
ATCTTCCTAACATTCAAAAATTCAACCTCAATGGCTTGAATCTTGACCTA
CAAACTGTACAAGAACTGTTCTCTGTAGATGCTGAGGGTTGGCTTGCTGA
AGTTGAGAACATTGGGGAGTATTTGAAGATCTTTGGTTCGGATTGTCCGC
AGCAGATTACTGATGAGTTGTTGCGAATTAAATCAGAATTAAAAGAAAAA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy