Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_2 IGR680 IGR679 IGR682 IGR681 IGR678 tig, - CPn0848 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 tig, - CPn0848 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 tig, - CPn0848 mreB, - CPn0850 CPn0853 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0850

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mreB  

Definition:
Rod shape determining protein MREB/HSP70 sugar kinase

Gene Start:
965293

Gene Stop:
966393

Gene Length:
1101

Molecular Weight*:
39527

pI*:
8.90

Net Charge*:
6.47

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:
See CT709.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to rod shape-determining protein sequences; e.g. residues 1-366 are 95% similar to CT709; residues 32-350 are 53% similar to TP0497; residues 36-220 are 25% similar to MG305; residues 36-308 are 225 similar to UU339; residues 28-359 are 55% similar to MREB_BACSU; and residues 27-356 are 57% similar to MREB_ECOLI.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1077
COG name: HSP70 class molecular chaperones involved in cell morphogenesis
Functional Class:  D
The phylogenetic pattern of COG1077 is a-t-YqV-eB-huj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 120-171 and 179-218 represent blocks BL00297C-D (Heat shock hsp70 proteins family proteins) with a combined E-value of 3.3e-05.

ProDom Summary:  Protein Domain Search
Residues 35-332 are 58% similar to a defined domain of O33619_STRCO, defined as: CELL PROTEIN DIVISION SHAPE FTSA ROD SHAPE-DETERMINING MREB MBL MREB-LIKE.

Paralogs:  Local Blast Search
Weak indication of paralogy to CPn0503, a predicted heat shock protein-70 sequences. Residues 129-220 are 31% similar.

Pfam Summary:  Pfam Search
Residues 33 to 360 (E-value = 1.3e-228) place CPn0850 in the MreB_Mbl family which is described as MreB/Mbl protein (PF06723)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
49  
209

PDB Hit:


Gene Protein Sequence:
MSPHRNLFKLKNFSNRLYNRALGRFDKVFNFFSGNVGIDLGTANTLVYVR
GRGIVLSEPSVVAVDAQTHAVLAVGHKAKAMLGKTPRKIMAVRPMKDGVI
ADFEIAEGMLKALIKRVTPSRSVFRPRILIAVPSGITGVEKRAVEDSALH
AGAQEVILIEEPMAAAIGVDLPVHEPAASMIIDIGGGTTEIAIISLGGIV
ESRSLRIAGDEFDECIINYMRRTYNLMIGPRTAEEIKITIGSAYPLGDQE
LEMEVRGRDQVAGLPITKRINSVEIRECLAEPIQQIIECVRLTLEKCPPE
LSADLVERGMVLAGGGALIKGLDKALSKNTGLSVITAPHPLLAVCLGTGK
ALEHLDQFKKRKGNLV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTCCACATCGCAATCTGTTTAAACTTAAGAATTTTTCCAATCGCCT
TTACAACAGGGCTTTGGGTCGTTTCGACAAGGTCTTTAATTTTTTTTCTG
GTAATGTTGGCATTGATTTAGGCACTGCAAACACTTTGGTTTATGTCCGA
GGTCGGGGTATTGTTCTTAGTGAACCTTCTGTAGTTGCTGTGGATGCACA
GACGCATGCAGTGCTTGCTGTAGGGCATAAGGCGAAAGCGATGTTGGGTA
AGACGCCCAGAAAGATTATGGCAGTGCGTCCTATGAAGGATGGGGTAATT
GCTGATTTTGAGATTGCTGAGGGCATGTTAAAGGCTTTAATTAAACGTGT
AACTCCTTCTCGTAGTGTTTTTCGCCCAAGAATTTTAATTGCTGTTCCTT
CTGGGATTACTGGAGTAGAAAAACGTGCTGTTGAAGATTCTGCATTACAT
GCTGGGGCTCAGGAAGTAATCTTAATTGAAGAACCTATGGCTGCTGCGAT
AGGTGTGGATCTGCCTGTTCATGAGCCTGCAGCGAGTATGATTATTGATA
TTGGAGGAGGCACTACCGAGATTGCTATTATTTCTTTGGGAGGAATTGTT
GAATCTCGTTCTTTGCGTATTGCTGGGGACGAATTTGATGAGTGTATCAT
TAACTACATGCGTCGTACGTACAATTTAATGATAGGTCCTCGTACTGCTG
AAGAAATCAAGATTACCATTGGCTCGGCCTATCCTTTAGGGGATCAGGAG
TTGGAGATGGAAGTTCGAGGTCGTGATCAGGTGGCGGGCTTGCCGATTAC
CAAGCGTATTAATTCTGTGGAGATTAGAGAGTGTTTGGCTGAACCTATTC
AGCAGATCATAGAATGTGTACGTTTGACATTAGAGAAGTGTCCACCAGAA
CTTTCTGCTGATTTAGTAGAACGTGGTATGGTTTTAGCTGGAGGGGGCGC
TTTAATTAAGGGATTAGATAAGGCTTTGAGTAAGAACACAGGACTTTCTG
TGATTACAGCACCGCATCCTTTGCTGGCAGTTTGTTTAGGAACCGGGAAA
GCTTTGGAACATTTAGATCAGTTTAAGAAGCGTAAAGGGAATTTGGTATA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy