Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_2 IGR680 IGR679 IGR676 IGR681 IGR677 IGR678 clpP_2, - CPn0847 clpX, - CPn0846 tig, - CPn0848 mreB, - CPn0850 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 clpP_2, - CPn0847 clpX, - CPn0846 tig, - CPn0848 mreB, - CPn0850 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849 clpP_2, - CPn0847 clpX, - CPn0846 tig, - CPn0848 mreB, - CPn0850 pckA, - CPn0851 CPn0852 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0849

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
snf  mot1  

Definition:
SNF2 family helicase

Gene Start:
961788

Gene Stop:
965288

Gene Length:
3501

Molecular Weight*:
133570

pI*:
5.90

Net Charge*:
-19.19

EC:
 

Functional Class:
transcription; RNA processing  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0849 is similar to MG018, a predicted helicase in M. genitalium. No similaritis to T. pallidum and U. urealyticum sequences.

CPn0849 is orthologously related to CT708 and they
share 82% similarity. CPn0849 is also similar to CT555, a predicted SNF2 helicase.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0553
COG name: Superfamily II DNA/RNA helicases, SNF2 family
Functional Class: K,L
The phylogenetic pattern of COG0553 is a--kY-vceBrh--gp--IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0849 is paralogously related to CPn0835, a predicated SWI/SNF family helicase_2: residues 694-1164 are 37% similar to residues 707-1183 of CPn0835.

Pfam Summary:  Pfam Search
Residues 55 to 92 (E-value = 3.1e-07) place CPn0849 in the SWIM family which is described as SWIM zinc finger (PF04434)
Residues 705 to 988 (E-value = 7.7e-90) place CPn0849 in the SNF2_N family which is described as SNF2 family N-terminal domain (PF00176)
Residues 1034 to 1110 (E-value = 7.5e-26) place CPn0849 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
91  
145
coil-coil  
1123  
1150

PDB Hit:


Gene Protein Sequence:
MLNFRKLRRDFSANILQDGKKLFEQGAVIDAKILSMNGETVCISAQVRGL
YDNIYECEIEVDRSESDTVDSNCDCSYNYDCQHIVALLFYLEQYFNEMVV
AYARSADLETDHEINEEVKKELKETFVAAATKEEERKDREHQKEILREYV
HAANALSANPFFLPLEYLEKDSAELAVLFVSVNEDTFAPANQPIEFQLVL
RLPCRSKPFYISNIRTFLEGVLYQEPIVLNGRRFFFTMQSFNASDRKLID
LLIRYVRYPNHTTEEKLLKSAYLMPPALGVILAKMFEHQLADRGGGSLGE
KESFSGLFCGNLEEPLCWSLTPAKMKFNLDFFDMPYKALLMTPVILVDDD
EVQPEQTMLLESDAPGIIHHFVYHRFSPQIKRAHLRSFSRLRDIAIPEAL
FGSFRENALPVFQEYAEIANVHLLNSFVTLPYVDEVRAICDMSYLDGELE
AKLHFLYGSLRVPAASLALQYQDVRAFISDEGILARNLVEERKMLEEVFS
GFIYDERDGAFRVKSEKKIVEFMTETIPANQHRITFNCPENLSGQFIYDE
TIFELSFREGSDINYYEADLKVHGLLKGVPLDLLWDCISAKKRFLELPKA
GQQSKGTRRGKVNSGKLPCILVLDLEKIAPVVQIFNEIGFKVLDDLVQKC
PLWSLTGISLDQFEALPVNFSMSERLIEIQKQIRGEIEFDFQDVPQQIQA
TLRSYQTEGVHWLERLRKMHLNGILADDMGLGKTLQAIIAVTQSKLEKGS
GCSLIVCPTSLVYNWKEEFRKFNPEFRTLVIDGVPSQRRKQLTALADRDV
AITSYNLLQKDVELYKSFRFDYVVLDEAHHIKNRTTRNAKSVKMIQSDHR
LILTGTPIENSLEELWSLFDFLMPGLLSSYDRFVGKYIRTGNYMGNKADN
MVALKKKVSPFILRRMKEDVLKDLPPVSEILYHCHLTESQKELYQSYAAS
AKQELSRLVKQEGFERIHIHVLATLTRLKQICCHPAIFAKDAPEPGDSAK
YDMLMDLLSSLVDSGHKTVVFSQYTKMLGIIKKDLESRGIPFVYLDGSTK
NRLDLVNQFNEDPSLLVFLISLKAGGTGLNLVGADTVIHYDMWWNPAVEN
QATDRVHRIGQSRSVSSYKLVTLNTIEEKILTLQNRKKSLVKKVINSDDE
VVSKLTWEEVLELLQI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAATTTTCGCAAGTTACGCCGGGATTTTTCAGCCAATATTTTACA
AGATGGTAAAAAACTTTTTGAGCAGGGGGCTGTGATTGATGCGAAAATCC
TTTCGATGAATGGAGAGACTGTCTGCATCAGCGCTCAGGTTCGGGGCTTG
TACGACAACATTTATGAGTGTGAGATTGAAGTTGATCGCTCGGAATCCGA
TACTGTGGATTCCAACTGTGATTGTTCGTATAACTACGACTGCCAGCACA
TCGTCGCACTATTATTCTATTTAGAGCAATATTTTAATGAGATGGTAGTA
GCCTATGCTCGTAGTGCTGATTTAGAAACGGATCACGAGATCAACGAGGA
AGTAAAAAAGGAGCTCAAGGAAACTTTTGTCGCTGCTGCCACAAAGGAAG
AAGAGCGTAAAGATCGTGAGCATCAAAAAGAGATTTTAAGAGAGTATGTT
CACGCTGCAAATGCTTTAAGTGCGAATCCTTTTTTCCTACCTTTAGAATA
TTTAGAAAAGGATTCTGCTGAGCTTGCTGTATTATTTGTTTCTGTAAATG
AGGATACGTTTGCTCCTGCCAATCAGCCTATAGAGTTTCAATTAGTACTT
CGTTTACCGTGTCGTTCCAAGCCTTTTTATATCTCTAATATCCGTACCTT
TTTGGAAGGGGTGTTGTATCAGGAGCCAATTGTATTGAATGGGCGTCGGT
TTTTCTTTACGATGCAATCGTTTAATGCTTCCGATCGCAAGCTAATAGAT
TTATTGATTCGCTATGTCCGTTACCCCAATCATACAACCGAAGAGAAGTT
ATTAAAATCTGCGTATTTGATGCCTCCTGCGTTAGGTGTGATTCTTGCAA
AGATGTTTGAACATCAACTGGCAGATCGTGGAGGAGGAAGTTTAGGGGAA
AAAGAGAGTTTTTCAGGGTTATTCTGTGGAAATCTTGAAGAGCCTCTGTG
TTGGTCATTAACTCCGGCTAAGATGAAGTTTAACTTAGACTTCTTTGACA
TGCCCTACAAAGCGTTGTTAATGACTCCTGTGATTCTTGTTGATGATGAT
GAAGTTCAGCCTGAGCAGACCATGTTATTAGAGTCGGATGCTCCAGGGAT
TATTCATCATTTTGTTTATCATCGGTTTTCTCCTCAGATCAAGCGTGCGC
ATTTACGTTCCTTTAGTCGTTTGCGAGATATAGCAATTCCAGAGGCTTTG
TTTGGTTCGTTCCGTGAGAATGCTCTTCCTGTATTTCAGGAATATGCTGA
AATTGCGAATGTTCACCTTTTGAATTCCTTTGTGACACTTCCTTATGTAG
ATGAGGTCCGGGCCATTTGTGATATGAGCTATTTGGACGGGGAATTAGAG
GCAAAATTACATTTCCTTTATGGTTCTTTACGGGTTCCAGCAGCATCTTT
GGCTTTGCAATATCAGGATGTTCGTGCCTTTATTAGTGATGAGGGAATCT
TAGCCAGAAATCTGGTTGAAGAGCGTAAGATGTTGGAAGAGGTCTTCTCA
GGCTTTATTTATGATGAACGCGATGGAGCTTTTCGTGTTAAAAGTGAGAA
GAAGATCGTGGAATTTATGACGGAGACGATCCCTGCGAATCAACATCGCA
TTACTTTTAACTGTCCGGAAAATCTTTCAGGTCAGTTTATTTATGATGAG
ACGATCTTTGAATTATCGTTCCGAGAAGGGAGCGACATTAATTATTATGA
GGCAGACCTTAAGGTTCATGGTTTATTGAAAGGAGTGCCTTTAGATTTAT
TGTGGGACTGCATTAGTGCGAAAAAGCGCTTTTTAGAGCTTCCTAAAGCG
GGTCAGCAATCTAAGGGAACGCGGCGCGGTAAGGTGAATTCGGGTAAGTT
GCCTTGTATTTTAGTCTTAGACTTAGAAAAAATTGCTCCTGTGGTGCAGA
TTTTTAATGAAATAGGATTTAAAGTTTTAGATGACTTAGTTCAGAAGTGT
CCTTTATGGAGTTTAACGGGAATTTCGTTAGATCAGTTTGAAGCACTTCC
TGTGAACTTTTCCATGTCTGAAAGGCTTATAGAGATTCAGAAGCAAATTC
GTGGTGAGATCGAGTTTGATTTCCAAGATGTTCCTCAGCAGATTCAGGCA
ACGTTACGTAGCTATCAAACCGAGGGCGTACATTGGTTAGAGCGTTTGAG
AAAAATGCATCTCAACGGGATTTTAGCTGATGATATGGGACTTGGAAAGA
CTCTCCAGGCGATTATTGCTGTTACTCAGAGTAAACTAGAGAAAGGCAGC
GGCTGTTCTTTGATTGTTTGTCCTACCTCTTTAGTTTATAACTGGAAGGA
AGAGTTCCGTAAATTTAATCCTGAATTCAGGACTTTAGTTATTGATGGAG
TTCCTTCTCAAAGACGGAAGCAGTTAACGGCTTTAGCTGATCGCGACGTC
GCGATTACTTCGTATAATTTATTACAGAAAGACGTGGAGTTATATAAGAG
CTTTCGTTTTGACTATGTTGTTTTAGATGAAGCGCACCACATTAAGAATC
GTACGACTCGGAATGCAAAATCGGTGAAGATGATTCAATCGGATCATCGG
TTGATATTAACTGGAACGCCGATAGAGAACTCGTTAGAAGAGTTATGGAG
TCTTTTTGATTTCTTAATGCCTGGTTTATTGAGCAGCTACGATCGCTTTG
TTGGAAAGTACATACGTACGGGCAACTATATGGGCAATAAAGCTGACAAT
ATGGTTGCGCTTAAGAAAAAGGTCTCACCTTTTATTCTTCGTCGTATGAA
AGAAGATGTATTGAAAGATCTTCCTCCGGTCTCTGAGATTTTATATCACT
GTCATCTTACAGAATCTCAGAAGGAGCTGTATCAGTCCTATGCAGCTTCT
GCGAAGCAAGAGCTTTCACGTTTGGTCAAGCAGGAAGGTTTTGAGCGTAT
CCATATTCATGTTTTAGCAACTTTGACTCGGTTAAAGCAAATTTGCTGTC
ATCCTGCTATTTTTGCTAAGGATGCTCCAGAGCCTGGGGATTCAGCAAAG
TATGATATGTTGATGGATCTACTTTCTTCTCTTGTGGATTCTGGGCATAA
GACTGTGGTCTTTAGTCAGTATACAAAGATGCTGGGCATTATTAAGAAAG
ATTTAGAGTCTCGAGGCATTCCTTTTGTCTATCTAGATGGTTCCACCAAG
AACAGACTAGATTTAGTGAATCAGTTTAATGAAGATCCTAGCTTGTTGGT
TTTCTTAATTTCCTTAAAAGCTGGGGGCACGGGCTTGAATCTTGTCGGTG
CTGATACAGTGATTCACTACGACATGTGGTGGAATCCTGCTGTAGAGAAT
CAAGCGACTGACCGAGTCCATCGTATTGGGCAGAGCCGTTCTGTCTCTTC
CTATAAATTGGTAACCTTGAACACGATTGAAGAAAAAATCCTTACTTTGC
AGAACAGGAAAAAGAGCCTTGTAAAGAAAGTGATTAACTCTGATGATGAG
GTTGTATCCAAGTTAACTTGGGAAGAAGTATTGGAATTGCTGCAGATATG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy