Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_2 IGR679 IGR676 IGR675 IGR674 IGR677 IGR678 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 mreB, - CPn0850 snf,mot1, - CPn0849 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 mreB, - CPn0850 snf,mot1, - CPn0849 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 mreB, - CPn0850 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0848

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tig  

Definition:
trigger factor -- peptidyl prolyl cis-trans isomerase

Gene Start:
961502

Gene Stop:
960174

Gene Length:
1329

Molecular Weight*:
49796

pI*:
4.90

Net Charge*:
-15.86

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:
A chaperone involved in protein export.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to trigger factor sequences; e.g. residues 3-441 are 64% similar to CT707; residues 26-385 are 21% similar to TP0506; residues 35-385 are 21% similar to UU347; residues 47-435 are 21% similar to TIG_ECOLI; and 23-384 are 22% similar to TIG_CAMJE.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0544
COG name: FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)
Functional Class:  O
The phylogenetic pattern of COG0544 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Resides 38-400 are 28% similar to a defined domain of O53189_MYCTU, defined as: TRIGGER FACTOR CHAPERONE TF CELL DIVISION ISOMERASE ROTAMASE TIG PUTATIVE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 10 to 165 (E-value = 5e-39) place CPn0848 in the Trigger_N family which is described as Bacterial trigger factor protein (TF) (PF05697)
Residues 251 to 426 (E-value = 2.8e-39) place CPn0848 in the Trigger_C family which is described as Bacterial trigger factor protein (TF) C-terminus (PF05698)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
266  
303
non-globular  
304  
384

PDB Hit:


Gene Protein Sequence:
VPRSLSNEQFSVDLEESPGCIVSALVKVSPEVLNKLNKQALKKIKKEITL
PGFRKGKAPDDVIASRYPTNVRKELGELVTQDAYHALSTVGDRRPLSPKA
VRSNSITQFDLQEGAKVEFSYEAFPAISDLPWENLSLPQEEAASEISDSD
IEKGLTNIGMFFATKTPVERPSQEGDFISISLHVSKSNDENASSAAIFEN
KYFKLSEEEMTDAFKEKFLGISTGHRVVETITSPEIQSFLRGDTLTFTVN
AVIEVSIPEIDDEKARQLQAESLDDLKAKLRIQLEKQAKDKQLQKRFSEA
EDALAMLVDFELPTSLLEERISLITREKLLNARLIQYCSDEELEKRKSEL
IKEAEEDATKALKLLFLTHKIFSDEKLTISREELQYMMDVCSRERFGQQP
PKDISNDTLQELVMSARDRLTYSKAIEHVLRKAELLASTPSA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCACGTAGTCTCTCCAATGAGCAGTTCTCCGTCGATTTAGAAGAATC
TCCTGGTTGTATTGTCTCAGCTTTAGTAAAAGTCTCCCCAGAAGTACTTA
ACAAACTCAACAAGCAAGCTCTTAAAAAGATTAAAAAAGAAATTACACTT
CCAGGATTCCGCAAAGGAAAAGCCCCTGATGATGTAATTGCATCCCGATA
TCCTACTAACGTAAGAAAAGAGTTAGGAGAACTAGTAACTCAAGACGCTT
ATCATGCCTTATCTACAGTCGGAGATCGTCGTCCTCTTTCGCCTAAAGCT
GTCCGTTCGAACTCAATCACTCAATTCGATCTTCAAGAAGGAGCCAAAGT
AGAGTTCTCTTATGAAGCTTTCCCTGCAATTTCTGATCTTCCTTGGGAAA
ACCTTTCTTTACCTCAGGAAGAAGCTGCTAGTGAGATTTCAGATAGTGAT
ATCGAGAAGGGACTCACAAACATTGGTATGTTCTTTGCAACAAAAACTCC
TGTAGAACGTCCTTCCCAAGAAGGCGATTTCATTTCTATTTCCTTGCACG
TCTCTAAAAGTAATGATGAGAATGCTTCCTCTGCAGCGATTTTTGAAAAC
AAATATTTTAAGCTTTCTGAAGAAGAAATGACCGATGCCTTTAAAGAAAA
ATTCTTAGGAATTTCTACTGGACATCGTGTTGTTGAGACAATTACCTCCC
CTGAAATTCAATCCTTCTTAAGAGGAGATACTTTAACATTTACAGTAAAC
GCTGTAATCGAAGTCTCGATCCCCGAGATAGATGACGAAAAAGCTCGTCA
ACTACAAGCAGAATCTCTAGACGATTTAAAAGCGAAATTACGCATACAAC
TAGAGAAGCAAGCTAAAGATAAACAATTGCAAAAACGCTTTTCTGAAGCT
GAAGATGCTCTTGCCATGCTCGTAGATTTTGAACTTCCTACCTCCCTGCT
TGAAGAACGTATTTCCTTAATCACAAGAGAAAAACTTCTTAATGCACGTC
TTATCCAATATTGTTCTGATGAAGAACTTGAAAAAAGAAAATCAGAACTT
ATCAAGGAAGCAGAAGAAGATGCTACAAAAGCATTAAAGTTACTGTTTTT
GACTCATAAAATTTTCTCTGATGAAAAACTCACCATTAGCCGCGAAGAAC
TGCAATACATGATGGATGTATGTTCAAGAGAGCGCTTCGGACAACAACCT
CCTAAAGATATTTCCAATGACACCTTACAAGAACTTGTAATGTCAGCCCG
CGATCGGCTGACCTATAGCAAAGCTATCGAACATGTTCTTCGCAAAGCAG
AACTGTTGGCTTCAACTCCTTCTGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy