Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Gly_2 IGR676 IGR675 IGR671 IGR673 IGR672 IGR674 IGR677 IGR678 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 secA, - CPn0841 snf,mot1, - CPn0849 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 secA, - CPn0841 snf,mot1, - CPn0849 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 CPn0842 secA, - CPn0841 snf,mot1, - CPn0849
* Calculated from Protein Sequence

Gene ID: CPn0845

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pcnB_1  

Definition:
poly(A) polymerase

Gene Start:
958079

Gene Stop:
956847

Gene Length:
1233

Molecular Weight*:
46906

pI*:
9.70

Net Charge*:
6.39

EC:
 

Functional Class:
transcription; RNA processing  

Pathway: pathway table

Comment:
Poly [A] polymerase creates the 3' poly (A) tail found in some
mRNA's. Seems to be involved in plasmid copy number control.
Poly(A) polymerase is a monomer.
Poly (A) polymerase is similar to members of the tRNA
nucleotidyltransferase / poly (A) polymerase family.

Blast Summary:  PSI-Blast Search
CPn0845 is orthologously related to CT704: residues 1-410 of CPn0845 are 65% similar to residues 1-410 of CT704, poly(A) polymerase from C. trachomatis.
CPn0845 is also similar to CT410, TP0270, TP0596.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class:  J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0845 is paralogous to CPn0966: residues 9-227 of CPn0845 are 36% similar to residues 45-263 of CPn0966

Pfam Summary:  Pfam Search
Residues 81 to 235 (E-value = 7.2e-62) place CPn0845 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
310  
410

PDB Hit:


Gene Protein Sequence:
MTTIAIEAAKKVLIKLRNAGYQAYFVGGCVRDMLMNRPLEDIDIATNASP
TIVSTIFPDVISIGVAFGIIVVKQDGRLFEVATFRSDGEYKDGRHPDRII
FSSMREDALRRDFTVNGMYYDPFEDKVFDFVEGTRDIEKKVIRAIGHPRL
RFSEDKLRILRAIRFSSSLGFTLDPTTERAIIKEAPALVNSVSPERIWQE
LKKMLKRQPYGALSLLLKLKVLIFIFPELRDIPYSLLRTTIEFARKFNPT
HFPEILFLLPLFQGVSEEAATVAFGRLRISNKELKLIESWYEALPHFQNQ
SGNRVFWAHFLASPTAPLFLELFSALQKDPSRQQHFISRVQELESRLEQF
ILRIKTSSPVVSAPDLIAKGISPGRLLGDLLREAEILSIENECLDKEKIL
LLLQEKGFWK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAATTGCCATAGAAGCTGCAAAAAAAGTTCTTATCAAACTACG
TAATGCAGGATATCAGGCATATTTTGTCGGTGGTTGTGTTCGAGATATGT
TAATGAATCGCCCTCTCGAGGATATTGACATAGCTACCAATGCATCCCCA
ACGATTGTATCTACGATCTTCCCAGACGTCATCAGTATTGGTGTTGCCTT
TGGTATCATCGTAGTAAAACAGGACGGACGCCTATTTGAAGTTGCAACTT
TCCGCTCTGACGGTGAATACAAAGATGGAAGGCATCCCGATCGTATCATC
TTTTCTTCTATGCGAGAAGATGCCCTCCGAAGAGACTTCACAGTAAACGG
GATGTACTACGATCCTTTTGAAGACAAAGTTTTCGACTTTGTCGAAGGAA
CTCGTGATATTGAAAAGAAAGTCATTCGAGCTATAGGCCATCCACGTTTA
AGATTCTCAGAAGATAAACTGCGTATCCTACGTGCCATACGTTTTTCTTC
CTCCCTCGGCTTCACCCTAGACCCAACTACAGAACGCGCCATTATTAAAG
AAGCCCCGGCATTAGTAAATTCCGTATCCCCGGAGAGAATCTGGCAAGAG
CTAAAAAAAATGCTTAAAAGACAGCCTTATGGAGCCCTCTCTCTTCTGCT
CAAGCTTAAAGTCTTAATTTTTATTTTCCCTGAACTACGTGATATTCCCT
ACAGTCTCTTAAGAACAACCATAGAATTTGCCCGTAAGTTTAATCCAACA
CATTTCCCTGAAATTCTTTTTTTACTGCCTCTATTCCAAGGGGTCAGTGA
GGAAGCCGCAACAGTAGCGTTTGGAAGATTACGAATTTCTAATAAAGAAT
TGAAATTAATAGAATCTTGGTACGAGGCACTCCCTCATTTCCAAAACCAA
TCCGGCAATCGTGTATTTTGGGCGCATTTCCTAGCGTCTCCGACAGCACC
TCTATTTTTGGAGCTCTTCTCGGCTCTACAAAAAGATCCGAGCAGACAGC
AGCACTTTATCTCTCGAGTGCAAGAACTCGAATCACGCTTAGAGCAATTC
ATATTAAGAATAAAAACATCCTCCCCCGTTGTTTCGGCTCCTGATCTGAT
AGCTAAGGGCATCTCTCCCGGAAGACTTCTTGGCGATCTACTCAGAGAAG
CTGAGATTCTCTCTATAGAAAATGAATGTCTCGACAAAGAAAAAATTTTA
TTGCTTTTACAAGAAAAAGGCTTTTGGAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy