Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR676 IGR675 IGR671 IGR673 IGR672 IGR674 IGR677 IGR670 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 CPn0840 secA, - CPn0841 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 CPn0840 secA, - CPn0841 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 tig, - CPn0848 yphC, - CPn0844 CPn0842 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0844

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yphC  

Definition:
THDF/YPHC-related GTPase

Gene Start:
956730

Gene Stop:
955267

Gene Length:
1464

Molecular Weight*:
55360

pI*:
8.50

Net Charge*:
8.80

EC:
 

Functional Class:
cellular processes; signal transduction  
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GTP-binding protein sequences; e.g. residues 4-481 are 30% similar to YFGK_ECOLI; residues 4-481 are 30% similar to YFGK_HAEIN; residues 3-480 are 28% similar to (AE000763) GTP binding protein Era [Aquifex aeolicus]; residues 1-485 are 64% similar to CT703; residues 1-485 are 30% similar to UU383; residues 4-485 are 30% similar to MG329; and residues 3-485 are 27% similar to TP0689.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1160
COG name: Predicted GTPases
Functional Class:  R
The phylogenetic pattern of COG1160 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 2-349 span four regions of similarity to blocks BL00905B,D (GTP1/OBG family proteins) with a combined E-value of 1.3e-05.

ProDom Summary:  Protein Domain Search
Residues 226-347 are 47% similar to a defined domain of O67749_AQUAE, defined as: PROTEIN GTP-BINDING LIPOPROTEIN PRENYLATION TRANSPORT FACTOR RAS-RELATED ELONGATION ADP-RIBOSYLATION BIOSYNTHESIS.

Paralogs:  Local Blast Search
Residues 149-422 are 28% similar to CPn0838.

Pfam Summary:  Pfam Search
Residues 71 to 378 (E-value = 9.5e-91) place CPn0844 in the MMR_HSR1 family which is described as GTPase of unknown function (PF01926)
Residues 222 to 405 (E-value = 8.1e-06) place CPn0844 in the GTP_EFTU family which is described as Elongation factor Tu GTP binding domain (PF00009)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
151  
181

PDB Hit:


Gene Protein Sequence:
MLKIAILGRPNVGKSSLFNRLCKRSLAIVNSQEGTTRDRLYGELHAFGVP
AQVIDTGGVDHNSEDYFQKHIYNQALTGAKEADVLLLVIDIRCGITEEDA
HLAKLLLPLKKPLILVANKADSRQEELQIHETYKLGIRDIVVTSTAHDKH
IDTLLQRIKLVANLPEPREEEEEGLEELSVDEHEESEAALPSNTFPDFSE
VFTEGFSPEEPCTIPESPQQAPKTLKIALIGRPNVGKSSIINGLLNEERC
IIDNTPGTTRDNIDILYSHKDRQYLFIDTAGLRKMKSVKNSIEWISSSRT
EKAISRADICLLVIDATQKLSSYEKRILSLISKRKKPHIILINKWDLLEE
VRMEHYCKDLRATDPYLGQAKMLCISATTKRNLKKIFSAIDELHHVVSNK
VPTPIVNKTLASALHRNHPQVIQGRRLRIYYAIQKTTTPLQFLLFINAKS
LLTKHYEYYLKNTLKSSFNLYGIPFDLEFKEKPKRHN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAAAAATAGCCATCTTAGGAAGACCCAATGTAGGAAAGTCATCACT
TTTCAATCGTCTATGTAAACGCTCTTTAGCAATTGTAAATTCTCAAGAGG
GGACAACTCGAGATCGCCTCTACGGCGAGCTCCATGCGTTTGGTGTTCCT
GCTCAGGTCATCGATACTGGAGGTGTTGATCACAATTCTGAAGATTACTT
CCAAAAGCATATCTATAACCAAGCCCTCACCGGCGCTAAGGAAGCTGATG
TCCTATTGCTAGTCATTGATATCCGCTGTGGTATTACCGAAGAAGATGCT
CACCTAGCCAAACTCCTCCTTCCCTTAAAGAAACCTCTCATCCTTGTCGC
CAATAAAGCAGACAGTCGCCAAGAGGAATTACAAATTCATGAGACCTATA
AATTAGGAATTCGAGATATTGTAGTGACCTCAACAGCTCACGATAAGCAC
ATTGATACCCTTCTTCAAAGAATTAAGTTGGTAGCCAACCTACCAGAACC
TCGCGAAGAAGAAGAAGAAGGCCTTGAGGAGCTTTCTGTAGATGAACACG
AAGAATCTGAGGCGGCTCTCCCTTCAAATACATTCCCTGATTTTTCAGAA
GTATTCACGGAAGGCTTCTCCCCTGAAGAACCCTGCACTATCCCAGAGTC
TCCTCAGCAAGCTCCCAAGACATTAAAAATAGCGCTCATCGGACGTCCTA
ACGTAGGGAAATCTTCTATTATTAACGGTCTTCTCAATGAAGAGCGTTGT
ATTATTGATAATACTCCTGGGACAACACGTGATAATATCGATATTCTGTA
TTCCCATAAGGACCGCCAGTATCTTTTCATTGATACTGCGGGTCTTAGAA
AAATGAAAAGCGTTAAGAATTCCATAGAATGGATTTCTTCATCTCGAACT
GAAAAAGCTATTTCTCGTGCTGATATCTGTCTTCTTGTGATTGATGCTAC
ACAAAAACTCTCTTCTTATGAGAAGCGCATCCTCTCTTTAATTTCTAAAC
GAAAAAAGCCTCACATCATATTAATTAACAAATGGGATTTACTTGAAGAA
GTCCGCATGGAGCATTACTGCAAAGATCTACGCGCTACTGATCCTTATTT
AGGACAAGCTAAAATGCTTTGTATCTCTGCTACTACGAAACGCAATCTTA
AAAAGATCTTCTCTGCAATTGATGAACTACATCACGTAGTATCGAATAAA
GTTCCAACACCGATAGTAAATAAAACTCTTGCTTCTGCTCTACATAGAAA
CCATCCTCAGGTGATTCAAGGACGCAGGTTGAGGATCTATTATGCAATCC
AAAAGACAACGACACCTCTGCAGTTTTTATTATTTATAAATGCAAAGTCT
CTATTAACAAAACATTATGAATATTATTTAAAAAACACATTAAAATCGTC
GTTTAATTTATATGGAATACCTTTCGATTTAGAATTTAAAGAAAAACCAA
AAAGACATAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy