Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR676 IGR675 IGR669 IGR671 IGR673 IGR672 IGR674 IGR670 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0842 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0843 clpP_2, - CPn0847 pcnB_1, - CPn0845 clpX, - CPn0846 yphC, - CPn0844 CPn0842 psdD, - CPn0839 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0842

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
954883

Gene Stop:
954707

Gene Length:
177

Molecular Weight*:
7012

pI*:
10.50

Net Charge*:
4.41

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT702, a Chlamydia-specific hypothetical protein. Residues 1-58 are 42% similar to CT702.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LLNAPKDFPNSKNQKHILFCIANNTLSHYAQFLIAGNRRKFWIRYYNDQV
WSEWTPFI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTCAACGCCCCTAAGGATTTTCCTAACTCCAAGAACCAAAAGCACAT
TCTTTTCTGTATAGCAAACAATACACTGAGCCACTATGCCCAGTTCCTCA
TAGCCGGCAATCGCAGAAAATTCTGGATTCGCTACTATAATGACCAAGTT
TGGTCAGAATGGACCCCATTTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy