Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR675 IGR669 IGR671 IGR673 IGR672 IGR674 IGR668 IGR670 CPn0842 CPn0843 pcnB_1, - CPn0845 clpX, - CPn0846 thdF, - CPn0838 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0842 CPn0843 pcnB_1, - CPn0845 clpX, - CPn0846 thdF, - CPn0838 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0843 pcnB_1, - CPn0845 clpX, - CPn0846 thdF, - CPn0838 yphC, - CPn0844 CPn0842 psdD, - CPn0839 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0841

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
secA  

Definition:
preprotein translocase subunit A protein

Gene Start:
951731

Gene Stop:
954643

Gene Length:
2913

Molecular Weight*:
111090

pI*:
6.10

Net Charge*:
-16.06

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:
This protein is thought to be active in protein export, interacting with secY/secE subunits.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to preprotein translocase SECA subunit sequences; e.g. residues 1-968 are 80% similar to CT701; residues 427-950 are 41% similar to TP0379; residues 427-917 are 39% similar to UU119; residues 427-917 are 38% similar to MG072; residues 397-933 are 42% similar to SECA_HELPY; and residues 341-930 are 39% similar to SECA_ECOLI.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0653
COG name: Preprotein translocase subunit SecA (ATPase, RNA helicase)
Functional Class:  N
The phylogenetic pattern of COG0653 is -----qvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 72-910 span ten regions of similarity to blocks BL01312A-J (Protein secA proteins) with a combined E-value of 6.4e-240.

ProDom Summary:  Protein Domain Search
Residues 503-913 are 39% similar to a defined domain of SECA_BACSU, defined as: TRANSPORT PREPROTEIN TRANSLOCASE SECA SUBUNIT PROTEIN ATP-BINDING TRANSLOCATION MEMBRANE CHLOROPLAST.
Residues 122-258 are 60% similar to a defined domain of SECA_SPIOL, defined as: TRANSPORT SECA PREPROTEIN TRANSLOCASE SUBUNIT PROTEIN ATP-BINDING TRANSLOCATION MEMBRANE CHLOROPLAST.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 557 (E-value = 5.8e-170) place CPn0841 in the SecA_protein family which is described as SecA protein, amino terminal region (PF01043)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
336  
363

PDB Hit:


Gene Protein Sequence:
MLGFLKRFFGSSQERILKKFQKLVDKVNIYDEMLTPLSDDELRNKTAELK
QRYQNGESLDSMLPEAYGVVKNVCRRLAGTPVEVSGYHQRWDMVPYDVQI
LGAIAMHKGFITEMQTGEGKTLTAVMPLYLNALTGKPVHLVTVNDYLAQR
DCEWVGSVLRWLGLTTGVLVSGTLLEKRKKIYQCDVVYGTASEFGFDYLR
DNSIATRLEEQVGRGYYFAIIDEVDSILIDEARTPLIISGPGEKHNPVYF
ELKEKVASLVYLQKELCSRIALEARRGLDSFLDVDILPKDKKVLEGISEF
CRSLWLVSKGMPLNRVLRRVREHPDLRAMIDKWDVYYHAEQNKEESLERL
SELYIIVDEHNNDFELTDKGMQQWVEYAGGSTEEFVMMDMGHEYALIEND
ETLSPADKINKKIAISEEDTLRKARAHGLRQLLRAQLLMERDVDYIVRDD
QIVIIDEHTGRPQPGRRFSEGLHQAIEAKEHVTIRKESQTLATVTLQNFF
RLYEKLAGMTGTAITESREFKEIYNLYVLQVPTFKPCLRIDHNDEFYMTE
REKYHAIVNEIATIHGKGNPILVGTESVEVSEKLSRILRQNRIEHTVLNA
KNHAQEAEIIAGAGKLGAVTVATNMAGRGTDIKLDNEAVIVGGLHVIGTT
RHQSRRIDRQLRGRCARLGDPGAAKFFLSFEDRLMRLFASPKLNTLIRHF
RPPEGEAMSDPMFNRLIETAQKRVEGRNYTIRKHTLEYDDVMNKQRQAIY
AFRHDVLHAESVFDLAKEILCHVSLMVASLVMSDRQFKGWTLPNLEEWIT
SSFPIALNIEELRQLKDTDSIAEKIAAELIQEFQVRFDHMVEGLSKAGGE
ELDASAICRDVVRSVMVMHIDEQWRIHLVDMDLLRSEVGLRTVGQKDPLL
EFKHESFLLFESLIRDIRITIARHLFRLELTVEPNPRVNNVIPTVATSFH
NNVNYGPLELTVVTDSEDQD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGGTTTTCTTAAACGCTTCTTTGGTTCCTCTCAAGAGCGTATTCT
AAAAAAATTTCAAAAACTTGTAGATAAAGTGAACATTTATGATGAAATGC
TCACGCCTTTATCTGATGATGAATTGCGGAATAAGACTGCGGAATTAAAG
CAGAGATATCAGAACGGAGAGTCTCTTGATAGCATGCTTCCTGAAGCTTA
TGGTGTCGTGAAAAACGTTTGTCGACGTTTAGCAGGCACCCCAGTCGAAG
TCTCCGGATACCATCAAAGATGGGATATGGTTCCTTATGATGTGCAGATT
CTAGGGGCCATTGCTATGCACAAGGGATTTATTACAGAGATGCAGACCGG
GGAGGGGAAAACACTCACTGCAGTGATGCCTCTGTATTTAAATGCTTTAA
CAGGCAAGCCAGTGCATTTGGTTACTGTTAACGACTATCTTGCACAACGA
GATTGTGAATGGGTAGGATCGGTACTGCGCTGGTTAGGACTTACAACGGG
AGTTTTGGTTTCAGGAACTCTTTTAGAAAAGCGTAAGAAAATTTATCAAT
GTGATGTTGTCTATGGTACAGCATCTGAGTTTGGTTTTGATTATTTGAGA
GATAATTCTATAGCTACTCGCCTTGAAGAGCAGGTAGGTAGAGGATATTA
CTTTGCTATCATTGATGAAGTCGACTCGATCTTAATAGATGAAGCTAGAA
CACCCTTAATTATCTCAGGTCCTGGAGAAAAACATAATCCAGTCTATTTT
GAGCTTAAAGAAAAAGTCGCAAGTCTAGTGTATTTGCAAAAAGAGCTCTG
CAGCCGTATCGCATTAGAAGCACGTCGCGGCTTAGATAGCTTTTTAGATG
TTGATATTCTTCCTAAAGATAAAAAAGTTCTTGAAGGCATCTCTGAATTT
TGCCGCAGCCTTTGGTTGGTAAGCAAAGGAATGCCTTTGAATCGTGTGTT
ACGTCGTGTACGTGAGCACCCAGATCTTCGTGCTATGATCGATAAATGGG
ATGTTTATTATCATGCTGAGCAGAATAAAGAAGAGAGCCTAGAGCGTCTT
TCAGAGCTCTACATTATTGTTGATGAGCACAATAATGATTTTGAGCTTAC
AGATAAAGGAATGCAGCAGTGGGTTGAGTATGCTGGAGGCTCTACCGAAG
AGTTCGTGATGATGGATATGGGGCATGAGTATGCTCTTATAGAAAATGAT
GAGACCCTATCACCTGCAGATAAGATCAATAAAAAAATTGCAATTTCTGA
AGAAGACACCTTAAGAAAGGCTCGTGCTCACGGATTACGACAGTTATTAC
GAGCCCAACTTCTCATGGAGCGTGATGTAGATTATATTGTCCGCGACGAT
CAGATTGTGATTATCGATGAACATACAGGACGTCCTCAACCTGGACGACG
TTTTTCTGAAGGCCTCCATCAAGCTATCGAAGCTAAAGAACACGTCACTA
TCCGTAAGGAATCTCAGACGCTTGCTACAGTCACGTTGCAAAATTTCTTC
CGTCTATATGAAAAGCTTGCAGGGATGACCGGAACAGCAATTACGGAGTC
TCGAGAGTTTAAAGAAATTTATAATCTTTATGTCCTCCAAGTACCCACGT
TCAAGCCTTGCTTACGCATAGATCATAATGATGAATTTTATATGACAGAG
CGTGAGAAGTACCACGCTATTGTTAATGAGATTGCGACTATTCATGGCAA
GGGGAACCCTATTCTTGTTGGTACAGAATCTGTAGAGGTCTCTGAGAAGC
TGTCTCGGATTTTGAGACAGAATCGGATAGAGCATACTGTATTGAATGCT
AAGAATCATGCTCAAGAAGCAGAAATTATAGCAGGAGCAGGGAAATTAGG
TGCTGTGACTGTAGCTACAAATATGGCTGGTCGAGGCACAGACATCAAAC
TAGATAATGAAGCTGTGATCGTAGGCGGTCTCCATGTGATCGGTACTACA
CGGCATCAATCCCGTCGAATTGATAGACAGTTGCGTGGGCGTTGTGCTCG
TTTAGGAGACCCTGGCGCTGCGAAATTCTTTTTATCTTTTGAAGATCGGC
TGATGCGACTATTCGCCTCCCCTAAATTGAATACCCTTATCCGTCATTTT
CGTCCTCCAGAAGGAGAGGCGATGTCGGACCCTATGTTTAATAGACTCAT
AGAAACAGCACAGAAACGTGTCGAAGGGAGAAACTATACTATCCGTAAGC
ATACCTTAGAGTATGATGATGTCATGAATAAGCAGAGACAAGCGATATAC
GCTTTCCGCCATGATGTCTTACATGCGGAATCTGTTTTCGATCTTGCAAA
AGAAATTCTATGCCATGTGTCTCTGATGGTAGCATCCTTAGTGATGAGTG
ATCGTCAGTTCAAAGGGTGGACATTGCCAAATCTTGAAGAATGGATAACC
TCATCTTTCCCAATAGCCTTAAATATAGAAGAACTCAGACAGCTTAAAGA
TACAGATTCTATTGCTGAAAAGATCGCTGCTGAATTGATTCAAGAGTTTC
AAGTACGCTTTGATCATATGGTAGAAGGGCTCTCCAAAGCTGGAGGGGAA
GAATTGGATGCATCTGCTATTTGTAGAGATGTCGTTCGGTCTGTCATGGT
CATGCATATTGATGAGCAGTGGCGGATTCATCTTGTAGATATGGACTTAC
TACGGAGTGAAGTTGGCCTACGTACTGTAGGGCAAAAAGATCCTTTGTTA
GAATTTAAACACGAGTCTTTCTTACTGTTTGAGAGCTTGATTCGTGATAT
TCGTATTACGATTGCGCGGCATCTTTTCCGTCTTGAACTGACCGTAGAGC
CTAATCCTCGTGTCAACAACGTGATTCCTACTGTAGCTACGTCTTTTCAT
AATAATGTGAATTACGGTCCGTTAGAGTTGACTGTAGTTACAGATTCTGA
AGATCAAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy