Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR667 IGR669 IGR671 IGR673 IGR672 IGR668 IGR670 IGR666 CPn0842 CPn0843 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0842 CPn0843 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 yphC, - CPn0844 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0843 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 yphC, - CPn0844 CPn0842 psdD, - CPn0839 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0840

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
950222

Gene Stop:
951547

Gene Length:
1326

Molecular Weight*:
50473

pI*:
8.50

Net Charge*:
10.48

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT700, a conserved hypothetical protein sequence. Residues 1-441 are 61% similar to CT700.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
Residues 173-197 represent block PF00515 (TPR Domain) with an E-value of 0.00023.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
16
non-globular  
17  
153

PDB Hit:


Gene Protein Sequence:
MWLVILWALAASLAIALVAKGYYRFVYFRRYAVQVIREVRLSMELKEWAL
AEQQLLPILKKRSYRRQCLFEYMRILRKMQRFEESEKLLAEAKKLGLRGP
YFFLEIAYKAYRFGAFKECAQAFASVPQDLFEEEDAAKYASALVRLGDLD
AACSLIEPWISPLSHQETFVTMGHIYFTSKRYKDAIDFYNRANALGVCPV
EVTYNLAQAYRITSSYAKAGKLFRKLLSNPVYKEEALFNIGLCEQKLGRP
GKALLIYQSSDLWSRGDALLMKYAAMAAMDQRDYVLAEPCWELALRCSTF
AKDYKCGLGYGFSLCRLRKYGDAERVYCNLIQNFPECLTACKALAWLCGV
GYATLLGSEEGLMYAKKAVELDHSCETLELLSACEARCGNFDAAYEIQSF
LSSRDTSLQEKQRRSQILRILRKKLPLNDHHIVEVDALLAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGTTAGTCATCTTGTGGGCTCTAGCTGCAAGTTTAGCAATAGCGCT
GGTCGCTAAAGGTTATTACCGCTTTGTTTATTTTCGTCGCTATGCTGTGC
AAGTTATACGAGAAGTACGCCTAAGTATGGAGCTCAAAGAATGGGCGCTT
GCAGAACAGCAACTCCTACCTATTTTAAAAAAACGGTCGTATCGACGGCA
GTGTTTATTTGAATATATGCGCATTCTACGCAAGATGCAGCGTTTCGAGG
AATCCGAGAAACTGCTTGCCGAAGCGAAGAAATTGGGATTGCGCGGTCCC
TATTTTTTCTTAGAAATTGCCTATAAAGCCTACAGGTTTGGGGCTTTTAA
AGAATGTGCACAGGCGTTTGCTTCCGTTCCTCAAGATTTGTTTGAAGAAG
AAGACGCTGCAAAATATGCTTCAGCTCTGGTGCGGTTAGGCGATTTAGAT
GCTGCCTGCAGTTTGATTGAACCATGGATTTCTCCCCTATCTCACCAAGA
AACTTTTGTGACTATGGGGCACATTTATTTCACTTCCAAGCGTTATAAAG
ATGCTATAGATTTTTATAATCGTGCGAATGCTTTGGGAGTCTGCCCTGTT
GAGGTCACCTATAATTTAGCACAAGCGTATCGCATTACCTCAAGCTATGC
AAAAGCAGGCAAATTATTCCGCAAACTCTTATCAAATCCTGTCTACAAAG
AAGAAGCTTTATTTAATATCGGGCTTTGTGAACAAAAGCTAGGCAGACCA
GGGAAAGCTCTACTTATTTATCAGAGCAGTGATCTTTGGTCTCGTGGGGA
TGCCTTGCTGATGAAATATGCAGCTATGGCAGCTATGGATCAACGAGATT
ATGTATTAGCAGAGCCCTGCTGGGAATTGGCTTTGCGCTGTTCCACATTT
GCTAAAGATTACAAATGCGGGCTAGGCTATGGCTTTAGCTTGTGTCGATT
ACGCAAGTATGGAGACGCAGAGCGTGTGTATTGTAATCTGATTCAAAATT
TCCCTGAATGTTTAACAGCGTGCAAGGCTTTGGCTTGGCTTTGTGGAGTT
GGGTATGCAACACTACTTGGTTCAGAAGAAGGCTTGATGTATGCGAAAAA
GGCCGTAGAACTCGACCATAGTTGTGAAACTTTAGAGTTATTAAGTGCAT
GCGAAGCACGTTGTGGAAATTTTGATGCTGCTTATGAAATTCAATCGTTT
CTTTCTTCTCGAGATACCTCTTTGCAGGAGAAACAACGACGTTCGCAGAT
TTTGCGAATTTTACGTAAAAAACTACCTCTCAACGATCATCATATTGTGG
AAGTGGATGCTCTGCTTGCCGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy