Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR667 IGR665 IGR669 IGR671 IGR668 IGR670 IGR666 CPn0842 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841 CPn0842 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0839

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
psdD  

Definition:
phosphatidylserine decarboxylase

Gene Start:
949257

Gene Stop:
950162

Gene Length:
906

Molecular Weight*:
34781

pI*:
10.40

Net Charge*:
17.16

EC:
4.1.1.65  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism

Comment:
This protein converts phosphatidylserine to phosphatidylethanolamine.

Blast Summary:  PSI-Blast Search
CPn0839 is orthologous to CT699, a predicted phosphatidylserine decarboxylase:
residues 6-295 are 52% similar to CT699. No similarity to T.pallidum, M.genitalium,
or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0688
COG name: Phosphatidylserine decarboxylase
Functional Class:  I
The phylogenetic pattern of COG0688 is amt-Y---ebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 88 to 295 (E-value = 5.5e-115) place CPn0839 in the PS_Dcarbxylase family which is described as Phosphatidylserine decarboxylase (PF02666)

PDB Hit:


Gene Protein Sequence:
VQKPQYIDRITKKKVIEPIFYEKTMLFLYNSKLGKKLSVFLSTHPIFSRI
YGWLQRCSWTRRQIRPFMNRYKISEKELTKPVADFTSFNDFFTRKLKPEA
RPIVGGKEVFITPVDGRYLVYPNVSEFDKFIVKSKAFSLPKLLGDHELTK
LYAHGSIVFARLAPFDYHRFHFPCDCLPQKTRCVNGALFSVHPLAVKDNF
ILFCENKRTVTVLETEQFGNVLYLEVGAMNVGSIVQTFSPNQTYAKGDEK
GFFAFGGSTVILLFLPNAIRFDNDLLKNSRMGFETRCLMGQSLGRSQREE
I$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAGAAGCCCCAATATATTGATCGAATCACTAAAAAAAAAGTAATAGA
ACCTATATTTTATGAAAAAACAATGCTCTTCCTATACAACTCTAAGCTAG
GGAAGAAGCTCTCAGTATTTCTATCAACACACCCCATCTTTTCTCGAATT
TATGGCTGGCTTCAAAGGTGTTCGTGGACACGTCGGCAAATTCGCCCTTT
CATGAATCGATATAAGATTTCTGAAAAAGAATTGACAAAGCCTGTTGCAG
ACTTCACCTCATTTAATGATTTTTTTACCCGGAAATTGAAACCCGAAGCA
CGCCCTATTGTTGGTGGGAAAGAGGTATTCATCACTCCTGTGGATGGACG
TTACCTTGTGTATCCTAATGTTTCGGAATTCGATAAGTTTATTGTTAAAT
CAAAAGCGTTTTCATTACCCAAGCTTTTAGGAGACCATGAGTTAACAAAA
TTATACGCTCATGGCAGCATTGTTTTTGCCCGCCTTGCCCCCTTTGATTA
CCATCGATTCCATTTTCCCTGTGATTGCCTTCCTCAAAAGACACGTTGTG
TGAATGGAGCGCTGTTCTCTGTCCATCCTTTAGCTGTTAAAGATAATTTC
ATTTTATTTTGTGAAAATAAACGGACGGTTACTGTACTCGAAACAGAGCA
GTTCGGCAACGTCCTCTATTTAGAAGTTGGAGCTATGAATGTAGGCTCCA
TTGTACAAACATTTTCTCCGAACCAAACCTATGCTAAAGGTGACGAGAAG
GGCTTTTTTGCTTTTGGCGGCTCTACAGTTATCTTGCTCTTTTTGCCTAA
CGCTATACGGTTCGATAACGATCTTTTGAAGAACTCACGTATGGGTTTTG
AAACACGCTGCTTGATGGGGCAGTCATTAGGTAGATCTCAGAGAGAAGAA
ATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy