Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR667 IGR665 IGR669 IGR668 IGR670 IGR666 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 psdD, - CPn0839 CPn0840 secA, - CPn0841
* Calculated from Protein Sequence

Gene ID: CPn0838

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thdF  

Definition:
thiophene and furan oxidation protein (GTPase)

Gene Start:
949106

Gene Stop:
947778

Gene Length:
1329

Molecular Weight*:
48703

pI*:
5.10

Net Charge*:
-13.50

EC:
 

Functional Class:
cellular processes; detoxification  
cellular processes; signal transduction  

Pathway: pathway table

Comment:
This protein binds GTP and is active in thiophene oxidation.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Thiophene/Furan Oxidation Protein sequences; e.g. residues 1-442 are 40% similar to THDF_SYNY3; residues 5-442 are 36% similar to THDF_BACSU; residues 5-442 are 36% similar to (AE000711) thiophene and furan oxidation protein [Aquifex aeolicus]; residues 1-442 are 65% similar to CT698; residues 7-442 are 31% similar to MG008; residues 6-442 are 32% similar to UU018; and residues 5-442 are 29% similar to TP0550.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0486
COG name: Predicted GTPases, ThdF family
Functional Class:  R
The phylogenetic pattern of COG0486 is ----yqvceb-hujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 24-214 are 37% similar to a defined domain of THDF_BACSU, defined as: PROTEIN THIOPHENE FURAN GTP-BINDING OXIDATION THDF POSSIBLE MITOCHONDRIAL GTPASE MSS1.
Residues 218-356 are 42% similar to a defined domain of P94612_COXBU, defined as: PROTEIN GTP-BINDING LIPOPROTEIN PRENYLATION TRANSPORT FACTOR RAS-RELATED ELONGATION ADP-RIBOSYLATION BIOSYNTHESIS.

Paralogs:  Local Blast Search
Possible paralogs include CPn0844 and CPn0478, both predicted GTP binding proteins. Residues 158-407 are 28% similar to CPn0844. Residues 220-336 is 27% similar to CPn0478.

Pfam Summary:  Pfam Search
Residues 81 to 336 (E-value = 1.8e-05) place CPn0838 in the MMR_HSR1 family which is described as GTPase of unknown function (PF01926)

PDB Hit:


Gene Protein Sequence:
MLKHDTIAAIATPPGEGSIAVVRLSGPQAIVIADRIFSGSVASFASHTIH
LGQVIFEETLIDQALLLLMRSPRSFTGEDVVEFQCHGGFFACSQILDALI
ALGARPALPGEFSQRAFLNGKIDLVQAEAIQNLIVAENIDAFRIAQTHFQ
GNFSKKIQEIHTLIIEALAFLEVLADFPEEEQPDLLVPQEKIQNALHIVE
DFISSFDEGQRLAQGTSLILAGKPNVGKSSLLNALLQKNRAIVTHIPGTT
RDILEEQWLLQGKRIRLLDTAGQRTTDNDIEKEGIERALSAMEEADGILW
VIDATQPLEDLPKILFTKPSFLLWNKADLTPPPFLDTSLPQFAISAKTGE
GLTQVKQALIQWMQKQEAGKTSKVFLVSSRHHMILQEVARCLKEAQQNLY
LQPPEIIALELREALHSIGMLSGKEVTESILGEIFSKFCIGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAAAGCACGATACCATTGCTGCCATTGCCACTCCTCCAGGGGAAGG
AAGTATTGCTGTTGTACGACTCTCTGGCCCACAAGCGATTGTCATTGCCG
ATCGTATTTTTTCTGGATCTGTGGCTAGCTTTGCCTCCCATACGATACAT
CTTGGACAAGTCATTTTTGAAGAGACATTAATTGACCAAGCTCTTCTTCT
TCTAATGCGCTCTCCTCGCTCCTTCACTGGAGAAGATGTAGTCGAATTTC
AGTGTCATGGAGGATTTTTCGCTTGCTCCCAAATTTTAGACGCTTTGATT
GCTTTAGGCGCCCGTCCTGCACTCCCTGGAGAGTTTTCTCAACGAGCGTT
TCTAAATGGAAAAATTGACCTGGTTCAAGCAGAGGCAATCCAAAATCTCA
TTGTTGCGGAAAATATAGACGCCTTTCGGATTGCTCAAACGCATTTTCAA
GGAAATTTTTCTAAGAAAATTCAAGAAATACATACTCTGATTATCGAAGC
ATTGGCGTTTTTGGAAGTCCTAGCCGACTTCCCTGAAGAAGAACAACCAG
ACCTCCTCGTCCCTCAAGAAAAAATTCAAAATGCTCTGCATATCGTGGAA
GATTTTATTTCCAGTTTTGATGAGGGGCAGAGGCTTGCTCAGGGAACAAG
TTTGATCCTTGCAGGGAAACCTAACGTAGGGAAATCCTCCCTACTCAATG
CGCTTCTTCAGAAAAATCGGGCGATTGTAACACATATTCCTGGAACCACT
CGTGATATCTTAGAGGAGCAGTGGCTCTTGCAAGGCAAACGCATCCGACT
GCTAGACACAGCAGGACAAAGAACAACAGACAATGACATTGAAAAAGAGG
GCATTGAACGAGCTCTTTCTGCTATGGAAGAAGCGGATGGGATCCTCTGG
GTAATAGATGCGACGCAACCTCTAGAAGATCTTCCTAAAATTCTTTTTAC
AAAACCTTCATTCCTCCTATGGAATAAAGCTGACCTCACCCCTCCTCCAT
TCCTTGACACTTCGCTCCCTCAATTTGCGATCTCAGCAAAAACTGGTGAG
GGACTTACTCAAGTGAAACAAGCTTTAATCCAATGGATGCAAAAACAAGA
GGCTGGAAAAACCTCTAAAGTGTTTTTAGTTTCTTCTCGCCATCACATGA
TCTTACAAGAGGTGGCTCGCTGTCTGAAAGAAGCGCAGCAAAACCTCTAT
CTGCAACCTCCAGAAATCATTGCTTTGGAGTTAAGAGAGGCACTTCACTC
GATTGGGATGCTTTCTGGCAAAGAAGTTACTGAAAGTATTTTAGGGGAAA
TTTTTAGTAAATTTTGCATTGGAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy