Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR667 IGR664 IGR665 IGR669 IGR668 IGR666 IGR663 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 CPn0834 psdD, - CPn0839 CPn0840 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 CPn0834 psdD, - CPn0839 CPn0840 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 mot1, - CPn0835 CPn0834 psdD, - CPn0839 CPn0840
* Calculated from Protein Sequence

Gene ID: CPn0836

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
braB  brnQ  

Definition:
branched-chain amino acid transport protein

Gene Start:
946879

Gene Stop:
945719

Gene Length:
1161

Molecular Weight*:
42506

pI*:
9.60

Net Charge*:
11.77

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
Integral membrane component of the Liv-II transport system for branched-chain amino acids.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to amino acid ABC transporter permease protein; e.g. residues 1-384 are 59% similar to CT554, a branched-chain amino acid transport protein; residues 2-353 are 26% similar to TP0265, an amino acid ABC transporter permease protein; residues 1-322 are 26% similar to BRNQ_BACSU; residues 1-364 are 23% similar to BRNQ_ECOLI; residues 1-363 are 23% similar to BRAB_PSEAE; and residues 1-364 are 22% similar to BRNQ_SALTY.
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1114
COG name: Branched-chain amino acid permeases
Functional Class:  E
The phylogenetic pattern of COG1114 is --------eB-h-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-353 are 29% similar to a defined domain of BRNQ_BACSU, defined as: TRANSPORT AMINO ACID CARRIER PROTEIN SYSTEM AMINO-ACID TRANSMEMBRANE BRANCHED-CHAIN CHAIN.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 384 (E-value = 1.8e-13) place CPn0836 in the Branch_AA_trans family which is described as Branched-chain amino acid transport protein (PF05525)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
28  
46
transmembrane  
61  
79
transmembrane  
105  
129
transmembrane  
134  
152
transmembrane  
177  
194
transmembrane  
230  
247
transmembrane  
269  
293
transmembrane  
314  
333
transmembrane  
338  
362
transmembrane  
367  
384

PDB Hit:


Gene Protein Sequence:
MFFGAGNIVFPLALGYHYNAHPWSAYFGMMLTAVCVPLLGLVSMLFYSGD
YQKFFFSIGRIPGMIFITAIILLIGPFGGIPRAIAVSHATLISLSEHKSA
FIPSLPIFSAICCVLIYIFSCKLSRLIQWLGSVFFPIMLVTLLWVIIRSF
MIPTHPMVQEFIPNARQAWLAGFIEGFNTMDLLAAFFFCSIVLISLRQLV
AEEKHPTEEEIPLSFQGISKKNKRSLALGFFLAAILLGMTYLGFVLSAAR
HAGLLVNVSKGHILGRISAIALGPNSILAGVSVFIACLTTEIALVGIVAD
FLARVVSFKKLNYASAVICTLIPTYLISILNFETISHLLLPLLQLSYPAL
IVLACGNIAYKLWNFRYSPVLFYLTLSLTIVLKLVN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCTTCGGAGCTGGCAATATTGTCTTTCCCTTAGCTCTGGGATACCA
CTACAATGCGCATCCCTGGTCTGCCTATTTCGGCATGATGCTTACTGCTG
TATGCGTTCCTCTTTTAGGTCTAGTCAGTATGCTATTCTATTCTGGAGAC
TACCAGAAGTTCTTTTTCTCGATAGGAAGAATTCCAGGGATGATTTTTAT
TACGGCTATTATACTTTTGATAGGCCCCTTCGGTGGAATCCCTCGAGCCA
TTGCAGTATCTCATGCCACATTGATTTCACTATCCGAGCATAAGAGTGCT
TTCATTCCCTCTTTGCCTATTTTTAGTGCGATTTGCTGTGTGCTTATCTA
TATCTTCTCATGCAAGCTCAGCCGTTTAATTCAATGGCTAGGATCTGTAT
TTTTCCCGATTATGTTGGTTACCTTACTTTGGGTCATCATCCGCAGTTTT
ATGATTCCTACCCACCCCATGGTTCAAGAATTTATTCCGAACGCACGTCA
AGCTTGGTTGGCAGGATTCATTGAAGGGTTCAATACTATGGATTTACTTG
CAGCGTTTTTCTTCTGCTCCATAGTTTTGATCTCTCTACGTCAGCTCGTA
GCTGAAGAGAAACATCCTACAGAGGAAGAAATCCCTCTTAGTTTTCAAGG
TATTAGCAAAAAAAATAAGCGTTCCTTAGCTTTAGGTTTCTTTCTTGCTG
CGATCTTACTAGGAATGACCTATCTTGGATTTGTTTTATCTGCTGCACGT
CATGCGGGCTTACTTGTGAATGTAAGTAAAGGTCATATTCTGGGAAGGAT
CTCTGCGATTGCATTAGGGCCAAATAGCATTCTCGCAGGAGTCAGCGTTT
TCATTGCCTGTCTAACTACGGAAATTGCTTTAGTAGGTATTGTTGCAGAT
TTTCTAGCTCGTGTAGTTTCCTTTAAGAAACTGAACTATGCTTCAGCAGT
AATTTGTACTCTTATCCCCACCTATTTAATTTCTATTTTGAATTTTGAAA
CTATAAGTCACCTACTCTTGCCTTTGCTACAACTTAGCTATCCAGCTTTG
ATTGTACTGGCTTGTGGAAACATTGCCTACAAGTTATGGAATTTCCGATA
CTCCCCAGTCTTGTTTTATTTAACCCTCTCTCTTACAATTGTTTTAAAGT
TAGTGAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy