Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR667 IGR664 IGR665 IGR666 IGR663 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 lpdA, - CPn0833 mot1, - CPn0835 CPn0834 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 lpdA, - CPn0833 mot1, - CPn0835 CPn0834 nth,end3, - CPn0837 braB,brnQ, - CPn0836 thdF, - CPn0838 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 CPn0834
* Calculated from Protein Sequence

Gene ID: CPn0835

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mot1  

Definition:
SNF2 Helicase

Gene Start:
945689

Gene Stop:
942042

Gene Length:
3648

Molecular Weight*:
138610

pI*:
6.00

Net Charge*:
-23.71

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0835 is similar to MG018, a predicted helicase in M. genitalium. No similarities to T. pallidum and U. urealyticum sequences.

CPn0835 is orthologously related to CT555, a predicted SNF2 helicase: residues 1-1208 are 60% similar to CT555. CPn0835 is also similar to CT708, a probable helicase.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0553
COG name: Superfamily II DNA/RNA helicases, SNF2 family
Functional Class:  K,L
The phylogenetic pattern of COG0553 is a--kY-vceBrh--gp--IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0835 is paralogously related to CPn0849, also predicted SWI/SNF family helicase_2: residues 707-1183 are 37% similar to 694-1164 of CPn0849.


Pfam Summary:  Pfam Search
Residues 721 to 1004 (E-value = 5.6e-57) place CPn0835 in the SNF2_N family which is described as SNF2 family N-terminal domain (PF00176)
Residues 1052 to 1128 (E-value = 4.3e-18) place CPn0835 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
287  
354
non-globular  
867  
960

PDB Hit:


Gene Protein Sequence:
MVLEALAIFRQDAMQHLLKHRKEIVVDFCEDSYTIRIPDEEAPEGYWLST
LKLQDIDRLTFASCSCPDGECCLHLMTAYFAVYDALGLHPLHDKFRHSFW
YAVFSHFFLDSIPLQAQGEMVYTLESPHITLTIECLSEEVFQDWLRTIHA
SEEPTVFTNKTFLKSALYRTAKKFFFLNEEGAELTIGENSQGFPSHFSLQ
WQGLVFKAEILDFPTLEDIFPKLELAHTSLENVSHDISITNVTVCAEEAK
VNFTLSPVIHKKDRENHPKTRIGSVEYVAKTHEMITGPKAIALPIYAIPL
LADKFKDQLLSLLCYDSLEYRLRYDIRLLRDASFSFSAYLVTPGDLDNGS
LIYPNYCYSPTKGLMQVVGMLSPKQAFIVKSEQVEDFLNERGHLIQEPGF
QTFINERPEGHLTYNVTEQGVLLFHYDVGDPSSTEIRFGTWTYYTNQGFF
LEKKNDLPIQDGLIVEPQDIPAFIVKNDAALRRLPNFFSSPPNLKDLLIE
VHRQSRGKGLDLKPILVGLGESRCWLFGVFLYREDIGFSLIPTPLQGLCF
LPRVIPPENVPQFLTQYAQHERILFPNPQTRPPESYELVIQSIHRPHPAS
PLHLQLELKTNLGSVPIGIALQGLKSKHTFLFTQAGFLDLKQNLFQFLKQ
FLSTQKCVIAENTVIANITDVFKLDALAPLSVTDDTIANPEDLQFFSQLK
AACLPPIPQNLFSSDHQLRPYQNSGLLWMWFLYNHRLSGLLCDEMGLGKT
HQATALLDIVFQSSQPSARPKFLIVCPTSVLPHWEHILSNHLPGVSIFSF
HGPNKPSELPPADILLTSYGTLRQNYDKFYKIAFTIVVFDEIHMAKNKSS
QIHKILCRIDAQMKLGLTGTPIENNLLEFKGLLDIILPNYLPSDALFKKL
FTKRCSSEELEEIIPSQDLLLKLTRPFILRRTKKLVLPELPDKVESIIAC
SLSPDQEKLYMATLQREKSHIQKLETPEEPATNFLHIFALLNHLKQICDH
PAVFFKDPDQYKNYESGKWNAFVKLLKESLNAGYKVVVFSQYIHMIRIIT
LYLEEIGIKYASIQGKSLNRKEEIETFTTDPNCQVFVGSLLAAGTGINLT
AGNVVIMYDRWWNPAKENQALDRVHRIGQKNTVFIYKLITEDTLEERIHY
LIEKKIRLLDKVIASQDSNILHMLNREDLLTILSYKDEHGTSDSEESPVD
APVEDDTGVLPPEDS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTAGAAGCATTAGCCATCTTTCGACAGGATGCGATGCAACATCT
CCTTAAACATCGCAAGGAGATCGTTGTAGACTTTTGTGAGGATAGTTACA
CCATACGCATTCCTGATGAAGAAGCTCCAGAGGGCTATTGGTTAAGCACT
TTAAAACTTCAAGATATTGATAGGCTAACTTTTGCTTCTTGCAGTTGTCC
TGACGGTGAGTGTTGTCTCCACCTTATGACTGCATATTTTGCTGTCTATG
ACGCTTTAGGATTGCACCCTTTACACGATAAATTCCGTCATTCCTTTTGG
TATGCCGTCTTCTCTCACTTTTTCCTCGACTCGATTCCATTACAAGCTCA
AGGAGAGATGGTTTATACACTAGAATCCCCACATATCACGTTAACAATAG
AGTGTCTGTCCGAGGAAGTATTCCAAGATTGGCTCCGCACCATTCATGCT
TCTGAAGAACCTACAGTATTTACAAATAAGACTTTCTTGAAGTCCGCTCT
CTATCGCACTGCTAAAAAATTCTTTTTCTTAAATGAAGAAGGGGCTGAGC
TTACGATAGGAGAAAATTCTCAAGGCTTTCCTTCTCATTTTTCTCTTCAA
TGGCAAGGCCTGGTCTTTAAAGCGGAAATCTTGGATTTTCCTACATTAGA
AGACATATTTCCTAAGTTGGAACTCGCGCATACATCTTTAGAGAATGTAT
CTCACGACATCAGTATTACAAATGTTACGGTCTGCGCAGAAGAAGCTAAG
GTAAATTTCACATTAAGTCCTGTTATCCATAAAAAAGACAGAGAGAATCA
TCCTAAGACTAGAATAGGTTCTGTAGAATACGTTGCAAAAACGCATGAAA
TGATCACAGGCCCTAAAGCCATAGCCCTTCCCATCTATGCGATTCCTTTG
CTCGCTGATAAATTCAAAGATCAGCTGCTTTCTTTGCTCTGCTATGATTC
TCTAGAATATCGACTACGCTATGATATCCGTCTACTACGTGACGCTTCCT
TCTCATTTTCTGCTTACCTCGTCACTCCTGGGGATTTAGACAATGGCAGT
CTCATTTACCCAAACTATTGCTATAGTCCTACGAAAGGTCTGATGCAAGT
CGTGGGGATGCTATCTCCAAAACAAGCGTTTATAGTTAAATCCGAACAGG
TTGAAGACTTTCTCAATGAGAGGGGGCATCTAATTCAAGAGCCCGGTTTC
CAAACATTTATAAACGAACGTCCCGAAGGTCATCTTACTTATAATGTCAC
AGAACAAGGTGTTTTATTATTCCACTATGATGTCGGAGATCCCTCTTCTA
CAGAAATACGTTTCGGGACATGGACCTACTATACAAATCAAGGTTTCTTT
CTAGAGAAGAAAAACGATTTGCCGATTCAAGATGGGCTCATTGTAGAACC
TCAAGACATCCCTGCTTTCATTGTAAAGAACGATGCGGCACTACGACGTC
TCCCCAATTTCTTTTCCTCTCCCCCTAATTTAAAAGACCTTCTTATTGAA
GTTCACAGGCAATCTCGTGGAAAAGGACTTGACCTCAAGCCTATTCTTGT
TGGTTTAGGGGAAAGCCGTTGTTGGCTATTTGGTGTATTTCTATATCGCG
AAGATATAGGATTCTCTTTGATTCCCACTCCCCTACAAGGGTTATGCTTT
CTACCTAGAGTCATTCCTCCTGAAAATGTCCCACAGTTTCTTACACAGTA
TGCGCAGCATGAGCGTATTTTATTTCCAAATCCGCAGACACGCCCTCCAG
AAAGTTATGAATTGGTGATCCAGTCGATTCATAGGCCTCATCCTGCCTCT
CCTCTCCATTTGCAATTGGAGCTGAAGACAAACCTCGGATCTGTCCCCAT
AGGAATCGCTTTACAAGGATTGAAAAGTAAACATACTTTTCTATTTACAC
AGGCTGGCTTTTTAGATTTGAAACAAAACCTGTTTCAATTTTTAAAACAG
TTCCTATCTACGCAGAAATGTGTGATCGCTGAGAACACTGTCATAGCGAA
TATTACTGACGTCTTTAAATTAGATGCTCTAGCTCCACTATCAGTAACTG
ATGATACTATAGCCAATCCCGAAGACTTGCAATTTTTCTCACAGTTAAAA
GCAGCGTGTTTACCTCCGATTCCACAAAATCTCTTTTCTTCAGACCACCA
GCTCCGCCCGTATCAAAACAGCGGGTTACTTTGGATGTGGTTCTTATACA
ATCACAGACTCTCAGGGCTTCTCTGTGATGAAATGGGATTAGGAAAGACT
CACCAAGCTACAGCCTTACTAGATATTGTATTTCAGTCTTCACAGCCCTC
AGCGCGCCCGAAATTCTTAATTGTATGTCCAACAAGTGTGTTACCACACT
GGGAGCATATTTTAAGTAATCATCTTCCTGGCGTGAGTATTTTTTCTTTC
CATGGGCCAAACAAACCGAGTGAGCTACCTCCTGCTGATATCTTGTTAAC
TTCTTATGGAACGCTACGACAAAACTACGATAAGTTTTACAAAATAGCAT
TCACAATTGTCGTTTTCGATGAGATCCACATGGCTAAAAACAAGAGTAGC
CAAATTCACAAAATCCTCTGTCGGATAGACGCTCAGATGAAGCTGGGACT
TACGGGAACTCCCATAGAGAACAATCTCTTAGAGTTTAAAGGGCTTTTAG
ACATTATCTTACCCAATTATCTTCCCTCTGACGCTCTATTCAAAAAGTTG
TTTACCAAACGATGTTCTTCTGAAGAATTGGAAGAGATTATCCCCTCCCA
GGATCTTTTATTAAAGTTGACTCGTCCTTTTATCTTGCGACGGACAAAAA
AACTGGTACTTCCCGAGCTTCCTGATAAGGTCGAATCTATCATTGCTTGT
TCGTTGTCTCCGGATCAGGAGAAGTTATATATGGCGACCTTGCAAAGAGA
GAAAAGTCATATTCAAAAGCTTGAAACTCCCGAAGAACCTGCTACGAATT
TCTTACACATTTTTGCTCTCTTAAATCATCTCAAGCAGATTTGTGATCAC
CCTGCAGTATTTTTCAAAGACCCGGATCAATATAAAAATTACGAATCTGG
AAAGTGGAATGCTTTCGTTAAGCTACTTAAGGAATCTTTAAACGCTGGAT
ACAAAGTTGTTGTATTCTCGCAATATATCCACATGATTCGGATCATTACT
CTCTATCTTGAGGAAATTGGGATCAAGTATGCTTCGATTCAAGGAAAATC
TCTGAATCGGAAGGAAGAAATTGAAACATTTACTACAGATCCTAATTGTC
AGGTGTTTGTTGGGTCGTTACTTGCGGCAGGAACAGGAATTAACCTGACT
GCAGGCAATGTGGTGATTATGTATGACCGTTGGTGGAATCCTGCCAAGGA
AAACCAAGCTCTAGACCGTGTGCATCGGATTGGTCAGAAAAATACAGTCT
TTATCTATAAGCTGATTACTGAAGATACACTTGAAGAGCGCATCCATTAT
TTAATTGAGAAGAAAATTCGCTTATTGGATAAGGTCATTGCCTCTCAAGA
TTCTAATATCCTACACATGTTGAATCGGGAAGATCTCCTCACTATACTAT
CCTACAAAGACGAACATGGAACTTCAGACAGTGAAGAGTCCCCTGTAGAT
GCACCCGTAGAAGATGATACAGGTGTGCTTCCCCCTGAGGATTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy