Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR664 IGR665 IGR660 IGR661 IGR662 IGR663 braB,brnQ, - CPn0836 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 braB,brnQ, - CPn0836 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 braB,brnQ, - CPn0836 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 CPn0831 CPn0834 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0834

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
941553

Gene Stop:
942017

Gene Length:
465

Molecular Weight*:
17104

pI*:
4.60

Net Charge*:
-5.76

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT556, a Chlamydia-specific hypothetical protein. Residues 1-153 are 68% similar to CT556.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
102  
120

PDB Hit:


Gene Protein Sequence:
MPFAKETEMQRTCWKCEGSVSMHVPQCPYCSAFLQDPPVASGGFSSCHIS
FPEGASKEEAEDLFAVSSEDWEAVLGDQNPTQETNKQVIPEWTWLQSWPL
AALFLGIGLLAFAFLILLFSTDSGLVLTWPKNRAYFYGIIGAAVAYRGYR
KLPL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCATTTGCTAAAGAGACAGAAATGCAAAGGACGTGTTGGAAGTGTGA
AGGCAGTGTATCTATGCACGTGCCTCAATGTCCCTATTGCAGCGCCTTTC
TTCAAGATCCTCCAGTAGCCTCAGGAGGGTTTTCTTCTTGCCACATCTCG
TTCCCAGAAGGAGCTTCTAAAGAAGAAGCCGAAGACCTATTTGCCGTCTC
TTCAGAAGATTGGGAAGCCGTGCTTGGAGATCAAAACCCTACTCAAGAAA
CGAATAAACAAGTGATCCCTGAGTGGACATGGTTACAAAGTTGGCCTCTT
GCAGCCTTATTTTTAGGCATAGGCTTGCTAGCGTTTGCCTTTCTGATTCT
TCTTTTCTCTACAGACAGTGGATTGGTTTTGACTTGGCCTAAAAATCGGG
CCTATTTTTACGGTATTATAGGTGCTGCAGTCGCCTATCGTGGATACCGT
AAACTTCCTCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy