Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR664 IGR660 IGR661 IGR662 IGR663 IGR659 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 CPn0831 CPn0834 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0833

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lpdA  

Definition:
pyruvate dehydrogenase E3 component(dihydrolipoamide dehydrogenase)

Gene Start:
941129

Gene Stop:
939744

Gene Length:
1386

Molecular Weight*:
49155

pI*:
6.70

Net Charge*:
-3.12

EC:
1.8.1.4  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Carbohydrate Metabolism; Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0833 is similar to MG271, a predicted
dihydrolipoamide dehydrogenase compoment E3
in M. genitalium. CPn0833 also shows weak
similarities to TP0921 and TP0814 in T. pallidum
and to UU074 in U. urealyticum.

CPn0833 is orthologously related to CT557:
residues 1-459 are 71% similar to residues
1-462 of CT557.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1249
COG name: Dihydrolipoamide dehydrogenase/glutathione oxidoreductase and related enzymes
Functional Class: C
The phylogenetic pattern of COG1249 is amt-YqvCEBRH--gp--inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0833 shows weak similarity to CPn0314, a
predicted thioredoxin reductase:residues 8-323
are 23% similar to residues 7-303 of CPn0314.

Pfam Summary:  Pfam Search
Residues 6 to 314 (E-value = 5e-97) place CPn0833 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)
Residues 338 to 447 (E-value = 2.2e-45) place CPn0833 in the Pyr_redox_dim family which is described as Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
47  
64
non-globular  
85  
133
transmembrane  
177  
198
transmembrane  
302  
319
transmembrane  
378  
398

PDB Hit:


Gene Protein Sequence:
MTQEFDCVVIGAGPSGYVAAITAAQSKLRTALIEEDQAGGTCLNRGCIPS
KALIAGANVVSHIKHAEQFGIHVDGYTIDYPAMAKRKNTVVQGIRQGLEG
LIRSNKITVLKGTGSLVSSTEVKVIGQDTTIIKANHIILATGSEPRPFPG
VPFSSRILSSTGILELEVLPKKLAIIGGGVIGCEFASLFHTLGVEITVIE
ALDHILAVNNKEVSQTVTNKFTKQGIRILTKASISAIEESQNQVRITVND
QVEEFDYVLVAIGRQFNTASIGLDNAGVIRDDRGVIPVDETMRTNVPNIY
AIGDITGKWLLAHVASHQGVIAAKNISGHHEVMDYSAIPSVIFTHPEIAM
VGLSLQEAEQQNLPAKLTKFPFKAIGKAVALGASDGFAAIVSHEITQQIL
GAYVIGPHASSLIGEMTLAIRNELTLPCIYETVHAHPTLSEVWAEGALLA
TNHPLHFPPKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCAAGAATTTGATTGTGTTGTTATTGGTGCGGGACCTAGTGGCTA
TGTTGCCGCAATCACTGCTGCGCAATCAAAATTACGGACCGCTCTTATTG
AAGAAGACCAGGCTGGGGGGACCTGCTTAAACCGCGGATGCATCCCTTCA
AAAGCCCTCATTGCTGGAGCCAATGTTGTATCTCACATTAAGCATGCGGA
GCAGTTCGGCATCCATGTTGATGGTTATACAATCGATTACCCTGCGATGG
CAAAAAGAAAAAATACAGTCGTCCAGGGGATCCGTCAAGGATTAGAAGGA
TTGATCCGCAGCAACAAGATTACTGTCTTAAAAGGAACCGGATCTCTAGT
ATCTTCTACAGAAGTTAAAGTTATTGGCCAAGACACGACTATAATCAAAG
CCAATCATATTATCCTAGCTACAGGATCCGAGCCTCGTCCTTTCCCAGGG
GTTCCCTTCTCCTCTAGAATTTTGAGTTCCACAGGGATCTTAGAACTTGA
AGTCCTCCCTAAAAAGCTCGCTATTATTGGTGGCGGCGTTATTGGCTGTG
AATTTGCGTCTCTATTTCACACTTTAGGCGTTGAGATTACCGTTATAGAA
GCTTTGGATCATATTCTTGCGGTTAACAATAAAGAAGTTTCTCAAACCGT
AACGAATAAATTTACGAAACAAGGAATTCGAATTCTTACCAAAGCCTCGA
TCTCTGCAATCGAAGAATCCCAAAACCAAGTTCGCATTACTGTGAACGAT
CAAGTGGAAGAGTTTGATTATGTCTTGGTGGCTATTGGTCGCCAATTTAA
TACAGCAAGTATAGGGCTAGATAATGCTGGAGTGATCCGGGACGATCGTG
GCGTGATTCCTGTTGACGAAACCATGCGCACTAATGTTCCAAATATCTAT
GCGATTGGAGACATCACTGGAAAGTGGCTACTTGCTCATGTGGCTTCGCA
CCAAGGCGTTATTGCCGCGAAAAATATTTCGGGACATCACGAAGTTATGG
ATTATTCTGCCATACCTTCTGTGATCTTTACCCACCCAGAAATTGCTATG
GTAGGTCTATCTCTACAAGAAGCAGAACAACAAAATCTTCCTGCAAAGCT
CACCAAATTTCCTTTTAAAGCGATTGGAAAAGCTGTTGCTTTGGGAGCAT
CTGATGGTTTTGCTGCTATTGTGAGTCATGAAATTACCCAGCAAATACTC
GGAGCTTATGTCATAGGACCTCACGCCTCATCATTAATTGGAGAGATGAC
CTTAGCGATCCGCAATGAGCTGACCCTACCTTGCATATATGAAACCGTGC
ATGCTCATCCCACACTCTCTGAAGTTTGGGCTGAAGGTGCTTTACTTGCT
ACAAATCACCCTTTACACTTCCCTCCTAAGTCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy