Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR664 IGR658 IGR660 IGR661 IGR662 IGR663 IGR659 yscL,sctL, - CPn0826 CPn0827 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscL,sctL, - CPn0826 CPn0827 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 CPn0827 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 yscL,sctL, - CPn0826 CPn0831 CPn0834 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0832

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lipA  

Definition:
lipoic acid synthetase

Gene Start:
939747

Gene Stop:
938824

Gene Length:
924

Molecular Weight*:
33980

pI*:
8.50

Net Charge*:
6.36

EC:
 

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; lipoate  

Pathway: pathway table

Comment:
The CT558 and CPn0832 proteins may play a role in sulfur insertion chemistry as a lipoic
acid synthetase.

Blast Summary:  PSI-Blast Search
CPn0832 is similar to CT558, a predicted lipoic acid synthetase.
Residues 8-307 are 67% similar to CT558. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0320
COG name: Lipoate synthase
Functional Class: H
The phylogenetic pattern of COG0320 is ----yq-Cebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 72 to 236 (E-value = 9.1e-16) place CPn0832 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:


Gene Protein Sequence:
MKCRPTLNTDQPRVRKKLPERFPKWLQRPLPQGSAFHATDATIKRSGMPT
VCEEALCPNRAECWSRKTATYLALGDVCTRSCGFCNIGHSKTPPALDPTE
PERIALSAKELGLKHVVITMVARDDLEDGGAQGLVDIIQKLREELPQATT
EVLASDFQGNVSALHTLLDSGITIYNHNVETVARLSPLVRHKATYARSMF
MLEQAANYLPDLKIKSGIMVGLGEMEGEVKQTLQDLASIGVRIVTIGQYL
RPSRKHLQVKSYVTPETFDYYRRVGEAMGLFVYAGPFVRSSFNADMILAS
VQDKASA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATGTAGACCAACTTTAAATACAGACCAACCTAGAGTGCGGAAAAA
GCTTCCCGAGCGTTTCCCCAAGTGGTTACAGAGGCCCTTACCACAAGGTT
CTGCATTTCATGCTACGGACGCTACAATAAAACGCTCAGGAATGCCAACG
GTATGCGAAGAAGCTCTCTGCCCCAATCGAGCAGAATGTTGGTCTCGTAA
AACTGCCACCTACCTTGCTCTCGGCGATGTCTGTACAAGAAGTTGCGGTT
TTTGCAATATTGGGCATTCTAAAACCCCACCCGCGCTAGATCCTACAGAA
CCCGAGCGCATTGCTTTGTCAGCGAAAGAACTGGGGTTGAAGCATGTGGT
AATCACCATGGTGGCTCGCGATGACCTTGAGGATGGTGGTGCACAAGGTT
TAGTCGATATCATTCAAAAGTTACGTGAAGAACTCCCTCAAGCGACTACA
GAAGTTTTAGCTTCTGATTTCCAAGGGAATGTTTCTGCTCTCCACACCCT
GTTAGATTCTGGCATTACTATTTATAATCATAATGTCGAAACTGTAGCGA
GGCTCTCGCCTCTAGTACGGCACAAAGCAACCTATGCCCGATCTATGTTC
ATGTTAGAACAAGCTGCCAACTACCTCCCCGATCTTAAAATCAAATCCGG
GATCATGGTAGGATTAGGTGAGATGGAAGGAGAAGTCAAACAAACTCTCC
AAGATCTGGCTTCCATAGGAGTTCGTATTGTCACTATAGGTCAATACTTA
CGTCCTTCTCGTAAGCATCTCCAAGTCAAAAGTTATGTGACTCCCGAGAC
TTTTGATTACTATCGTCGAGTCGGAGAAGCTATGGGTCTTTTTGTTTACG
CAGGACCTTTTGTACGCTCGAGTTTTAATGCCGATATGATCCTAGCTTCT
GTACAAGACAAAGCGTCAGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy