Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR657 IGR664 IGR658 IGR660 IGR661 IGR662 IGR663 IGR659 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 CPn0831 CPn0834 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0831

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
938267

Gene Stop:
938437

Gene Length:
171

Molecular Weight*:
6294

pI*:
6.80

Net Charge*:
-0.30

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
VLIRKSESEGAFFEATQNYPTIQQGYQLVRIREHNLSVRAHFDLSLSLDA
SVHPAA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTATAAGAAAATCTGAATCAGAAGGAGCTTTTTTTGAAGCAACTCA
AAATTATCCTACAATACAGCAAGGATATCAGCTGGTACGGATTCGTGAGC
ACAATCTTTCTGTCCGAGCACATTTTGACTTATCTCTATCTCTTGATGCA
TCAGTCCATCCCGCGGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy