Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR657 IGR664 IGR658 IGR660 IGR661 IGR662 IGR663 IGR659 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 CPn0831 CPn0834 CPn0830 CPn0829 yscL,sctL, - CPn0826 CPn0827 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 mot1, - CPn0835 lipA, - CPn0832 lipA, - CPn0832 CPn0831 CPn0834 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0830

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
937444

Gene Stop:
937962

Gene Length:
519

Molecular Weight*:
19562

pI*:
10.20

Net Charge*:
7.32

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hits to sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 16-164 are 51% similar to residues 33-180 of CPn0829.
Residues 95-161 are 41% similar to residues 51-116 of Cpn0221.
Residues 33-164 are 29% similar to residues 6-121 of CPn0223.
Residues 33-157 are 33% similar to residues 4-118 of CPn0226.
Residues 95-161 are 34% similar to residues 52-115 of CPn0220.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
1  
18
transmembrane  
90  
114
transmembrane  
138  
162

PDB Hit:


Gene Protein Sequence:
LIALLYNITLVLGLIFIHKKYLGQKGRVILKIYQNEEEFFRATERFPSIG
AGYLRVRNKNSVLFPFEDLMLVCPSVPKDFPLSAFKVTTKLIYWSVLESI
PVVGAFFFSIGRLFAMWCIEDFPGSIFSRIYHTIVGVLGILGLGIIMFIL
RIIFTLLTLPFWLISCLKSSAA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATAGCTTTGCTTTATAATATAACTCTCGTCTTAGGGCTTATTTTTAT
TCATAAGAAATACTTAGGACAAAAGGGGAGGGTAATTCTGAAAATTTATC
AAAATGAAGAAGAATTTTTTCGAGCAACTGAAAGGTTTCCATCAATAGGG
GCGGGGTATCTACGTGTTCGAAACAAAAACTCTGTATTATTTCCATTTGA
GGATTTAATGCTTGTATGCCCCTCAGTACCTAAAGACTTTCCACTTTCAG
CTTTCAAAGTAACAACTAAGCTTATCTATTGGAGTGTATTAGAGAGTATC
CCCGTCGTGGGAGCATTTTTTTTCAGTATAGGAAGACTCTTTGCTATGTG
GTGCATAGAAGATTTCCCAGGCTCTATTTTTTCTAGAATCTATCATACCA
TTGTTGGTGTTTTAGGAATTCTTGGTTTAGGAATCATCATGTTCATTTTA
AGAATTATCTTTACTTTGCTTACGCTACCCTTCTGGCTCATAAGTTGTCT
AAAATCAAGTGCTGCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy