Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR655 IGR656 IGR657 IGR658 IGR660 IGR654 IGR661 IGR662 IGR659 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 CPn0831 CPn0822 CPn0830 CPn0829 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 CPn0831 CPn0822 CPn0830 CPn0829 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 lipA, - CPn0832 lipA, - CPn0832 CPn0831 CPn0822 CPn0829 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0828

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yscJ  sctJ  

Definition:
YopJ translocation protein

Gene Start:
936271

Gene Stop:
935264

Gene Length:
1008

Molecular Weight*:
36232

pI*:
5.30

Net Charge*:
-4.50

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type III Secretion System

Comment:
YopJ translocation protein is required for the export process of the Yop proteins.

There is much speculation surrounding the function(s) of this protein in other bacteria, with
general agreement that it is concerned with transport or secretion possibly in association with pathogenicity.


Blast Summary:  PSI-Blast Search
CPn0828 is orthologously related to CT559: residues 1-322 of CPn0828 are 71% similar to residues 1-325 of CT559, a predicted flagellar M-ring protein and/or YopJ translocation protein from C. trachomatis.


COGS Summary:  COGS Search
BeTs to 6 clades of COG1766
COG name: Flagellar basal body M-ring protein FliF
Functional Class:  N
The phylogenetic pattern of COG1766 is -----qv-eb--uj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 208 (E-value = 9.6e-27) place CPn0828 in the YscJ_FliF family which is described as Secretory protein of YscJ/FliF family (PF01514)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
32  
102
transmembrane  
231  
255
non-globular  
283  
335

PDB Hit:


Gene Protein Sequence:
MVRRSISFCLFFLMTLLCCTSCNSRSLIVHGLPGREANEIVVLLVSKGVA
AQKLPQAAAATAGAATEQMWDIAVPSAQITEALAILNQAGLPRMKGTSLL
DLFAKQGLVPSELQEKIRYQEGLSEQMASTIRKMDGVVDASVQISFTTEN
EDNLPLTASVYIKHRGVLDNPNSIMVSKIKRLIASAVPGLVPENVSVVSD
RAAYSDITINGPWGLTEEIDYVSVWGIILAKSSLTKFRLIFYVLILILFV
ISCGLLWVIWKTHTLIMTMGGTKGFFNPTPYTKNALEAKKAEGAAADKEK
KEDADSQGESKNAETSDKDSSDKDAPEGSNEIEGA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTCGTCGATCTATTTCTTTTTGCTTGTTCTTTCTAATGACATTGCT
GTGCTGTACAAGCTGTAACAGCAGGTCTCTAATTGTGCACGGTCTTCCTG
GCAGAGAAGCGAATGAGATTGTGGTGCTTTTGGTAAGCAAAGGGGTGGCT
GCACAAAAATTGCCTCAAGCTGCAGCGGCTACAGCCGGAGCAGCTACTGA
GCAAATGTGGGATATCGCGGTTCCGTCAGCACAAATCACAGAGGCCCTTG
CCATTCTAAATCAAGCGGGTCTTCCACGTATGAAAGGGACAAGCCTGTTA
GATCTTTTTGCAAAACAAGGTCTTGTTCCTTCCGAGCTTCAGGAAAAAAT
CCGTTATCAAGAAGGCTTATCAGAACAGATGGCCTCTACGATTAGAAAAA
TGGATGGCGTTGTCGATGCCTCAGTACAGATTTCCTTCACTACAGAAAAT
GAAGATAATCTTCCTTTAACAGCCTCTGTGTATATTAAGCATCGAGGGGT
TTTGGACAATCCGAACAGCATTATGGTTTCCAAAATTAAGCGCCTTATTG
CAAGTGCTGTTCCAGGACTTGTGCCAGAGAACGTCTCTGTAGTGAGCGAT
CGCGCAGCTTATAGTGATATTACAATTAATGGTCCTTGGGGATTAACAGA
AGAAATCGATTATGTTTCTGTTTGGGGTATTATTCTTGCGAAGTCTTCGC
TCACCAAATTCCGTCTCATTTTTTATGTCTTGATTCTCATTTTATTTGTT
ATTTCTTGTGGTCTCCTTTGGGTCATTTGGAAAACTCATACTCTCATTAT
GACTATGGGAGGTACAAAAGGGTTCTTCAACCCTACACCATATACAAAGA
ATGCCTTGGAAGCCAAGAAAGCCGAGGGAGCAGCTGCTGACAAAGAGAAA
AAAGAAGATGCAGATTCACAGGGGGAAAGCAAAAATGCGGAAACCAGTGA
TAAAGACTCTAGTGATAAAGATGCTCCAGAAGGAAGCAATGAAATTGAGG
GTGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy