Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR655 IGR656 IGR657 IGR653 IGR658 IGR660 IGR654 IGR661 IGR662 IGR659 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 CPn0831 CPn0822 CPn0830 CPn0829 CPn0821 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lpdA, - CPn0833 CPn0831 CPn0822 CPn0830 CPn0829 CPn0821 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 lipA, - CPn0832 lpdA, - CPn0833 lipA, - CPn0832 CPn0831 CPn0822 CPn0829 CPn0821 CPn0830
* Calculated from Protein Sequence

Gene ID: CPn0827

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
935264

Gene Stop:
934431

Gene Length:
834

Molecular Weight*:
31775

pI*:
8.10

Net Charge*:
3.93

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0827 is orthologously related to CT560: residues 1-277 of CPn0827 are 63% similar to residues 1-278 of CT560, a hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
91  
109
transmembrane  
132  
154

PDB Hit:


Gene Protein Sequence:
VTANTFGTLDILMKHSKEDDLSRFLPKNLLVESPHPEEIPLKSLSFTMSW
LPTIHPSWITIAMKEFPPEIQGQLLAWLPEPLVQEILPLLPGISIAPHRC
APFGAFYLLDMLSKKIRPCGITEEIFLPASSANAILYYTGPVKIALINCL
GLYSIAKELKHILDKVVIERVKNALSPTEKLFLTYCQSHPMKHLETTNFL
SSWTTDAELRQFVHKQGLEFLGKALTKENASFLWYFLRRLDVGRAYIVEQ
TLKTWYDHPYVDYFKSRLEQCMKVLVK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACTGCCAACACTTTTGGAACTCTAGACATCTTGATGAAGCACTCCAA
GGAAGATGACCTCTCCAGGTTTCTTCCTAAAAATCTTCTTGTTGAATCTC
CTCATCCCGAAGAAATCCCTTTAAAATCTTTATCTTTTACGATGAGTTGG
CTACCTACAATTCATCCTTCATGGATTACCATTGCCATGAAAGAGTTCCC
TCCTGAAATCCAAGGTCAATTATTAGCGTGGTTGCCAGAGCCTTTAGTTC
AAGAAATTCTACCCTTACTGCCTGGCATCTCTATAGCCCCACATCGCTGT
GCACCTTTCGGAGCCTTCTATCTTCTAGATATGCTAAGTAAAAAGATCCG
TCCTTGTGGAATTACAGAAGAAATCTTTCTTCCTGCATCCTCAGCAAATG
CTATACTTTACTATACAGGTCCTGTAAAGATCGCTTTAATCAACTGCCTA
GGTCTTTATTCTATTGCTAAAGAGTTGAAGCACATTCTGGATAAGGTTGT
GATTGAACGAGTGAAGAATGCTCTCTCCCCTACAGAGAAACTCTTTCTTA
CCTACTGCCAATCTCATCCGATGAAACATTTAGAAACTACGAATTTTCTT
TCTTCTTGGACTACTGATGCAGAATTACGACAGTTCGTTCATAAGCAAGG
GTTAGAGTTTTTAGGTAAAGCATTAACAAAAGAAAACGCTTCTTTTCTAT
GGTATTTTCTACGTAGGTTAGATGTCGGTCGAGCATATATCGTCGAGCAG
ACTTTAAAAACATGGTATGACCATCCCTATGTGGATTATTTTAAGTCCCG
CCTAGAACAATGCATGAAAGTCTTAGTGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy