Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR652 IGR655 IGR656 IGR657 IGR653 IGR658 IGR660 IGR654 IGR661 IGR662 IGR659 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 lipA, - CPn0832 yscJ,sctJ, - CPn0828 CPn0831 CPn0822 CPn0830 CPn0820 CPn0829 CPn0821 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 lipA, - CPn0832 yscJ,sctJ, - CPn0828 CPn0831 CPn0822 CPn0830 CPn0820 CPn0829 CPn0821 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 lipA, - CPn0832 yscJ,sctJ, - CPn0828 CPn0831 CPn0822 CPn0829 CPn0821 CPn0819 CPn0820 CPn0830 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0826

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yscL  sctL  

Definition:
YopL translocation protein

Gene Start:
934310

Gene Stop:
933609

Gene Length:
702

Molecular Weight*:
25825

pI*:
4.80

Net Charge*:
-9.59

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type III Secretion System

Comment:


Blast Summary:  PSI-Blast Search
CPn0826 is orthologously related to CT561: residues 1-233 of CPn0826 are 61% similar to residues 1-223 of CT561, a predicted flagellar assembly protein fliH (YopL translocation protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1317
COG name: Flagellar assembly protein FliH
Functional Class:  N
The phylogenetic pattern of COG1317 is ------v-eb--uj--olin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
25  
89

PDB Hit:


Gene Protein Sequence:
MKFFSLIFKDDDVSPNKKVLSPEAFSAFLDAKELLEKTKADSEAYVAETE
QKCAQIRQEAKDQGFKEGSESWSKQIAFLEEETKNLRIRVREALVPLAIA
SVRKIIGKELELHPETIVSIISQALKELTQNKHIIISVNPKDLPLVEKSR
PELKNIVEYADSLILTAKPDVTPGGCIIETEAGIINAQLDVQLDALEKAF
STILKAKNPVDEPSETSSSTDSSSLSNDQDKKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTTTTTAGCTTAATTTTTAAAGATGATGATGTCTCCCCAAATAA
GAAGGTTTTATCTCCTGAAGCTTTCTCTGCTTTCCTTGATGCCAAAGAGC
TGTTAGAAAAAACAAAAGCCGATAGCGAAGCCTATGTTGCAGAGACAGAA
CAAAAGTGTGCACAAATTCGTCAAGAAGCTAAAGATCAAGGATTTAAAGA
GGGATCTGAATCCTGGAGCAAGCAAATTGCTTTCTTAGAAGAAGAAACTA
AAAATCTACGCATAAGAGTACGCGAGGCCTTGGTTCCTCTGGCAATTGCG
AGTGTGAGGAAAATCATTGGGAAGGAACTCGAATTACATCCTGAAACTAT
TGTCTCTATTATTTCTCAAGCATTGAAAGAGCTCACACAAAATAAACATA
TCATTATCTCTGTCAATCCCAAAGATTTACCTCTTGTTGAGAAAAGTCGT
CCTGAACTCAAGAACATCGTGGAGTATGCTGACTCCTTAATTCTTACAGC
AAAACCTGATGTTACTCCTGGGGGTTGCATTATCGAGACTGAAGCAGGGA
TCATCAATGCGCAGCTTGATGTACAATTAGATGCCTTAGAAAAAGCTTTC
TCGACTATACTAAAAGCGAAGAACCCTGTAGACGAGCCATCTGAGACTTC
ATCATCCACGGATTCTTCTTCTTTATCTAATGATCAGGATAAGAAAGAAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy