Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR656 IGR657 IGR650 IGR653 IGR658 IGR660 IGR654 IGR661 IGR659 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0830 CPn0820 CPn0829 CPn0821 gspF, - CPn0817 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0830 CPn0820 CPn0829 CPn0821 gspF, - CPn0817 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0822 CPn0829 CPn0821 gspF, - CPn0817 CPn0819 CPn0820 CPn0818 CPn0830 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0825

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sctR  yscR  

Definition:
YopR translocation protein

Gene Start:
933594

Gene Stop:
932674

Gene Length:
921

Molecular Weight*:
33810

pI*:
7.70

Net Charge*:
1.24

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type III Secretion System

Comment:


Blast Summary:  PSI-Blast Search
CPn0825 is orthologously related to CT562: residues 1-306 of CPn0825 are 71% similar to residues 1-306 of CT562, a predicted flagellar biosynthetic protein (FLIP) (YopR translocation protein) from C. trachomatis.
CPn0825 is also similar to TP0718, a predicted flagellar biosynthetic protein from T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1338
COG name: Membrane protein FliP involved in flagellar biogenesis
Functional Class:  N
The phylogenetic pattern of COG1338 is -----qv-eb--Uj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 94 to 302 (E-value = 1.9e-75) place CPn0825 in the FliP family which is described as FliP family (PF00813)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
non-globular  
24  
83
transmembrane  
92  
116
transmembrane  
136  
153
transmembrane  
222  
239
transmembrane  
244  
266
transmembrane  
271  
295

PDB Hit:


Gene Protein Sequence:
MRSIFRFSLCFFTLSVSCCFADASLYENSCPSRCQPTPPPSNSNPLNVVQ
QPVAASSVPSYMPPLNADDVLPRDHLSDGSFSDTYPDITTQAIILIFLAL
SPFLVMLLTSYLKIIITLVLLRNALGVQQTPPSQVLNGIALILSIYVMFP
TGVAMYKDARKEIEANTIPQSLFTAEGAETVFVALNKSKEPLRSFLIRNT
PKAQIQSFYKISQKTFPSEIRAHLTASDFVIIIPAFIMGQIKNAFEIGVL
IYLPFFVIDLVTANVLVAMQMMMLSPLSISLPLKLLLIVMVDGWTLLLQG
LMISFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGATCCATTTTTCGATTTTCCCTTTGTTTTTTTACGCTGAGCGTCTC
ATGCTGTTTTGCTGACGCCAGTCTATATGAAAACTCCTGTCCCTCGCGTT
GTCAACCTACCCCTCCTCCCTCGAATTCTAATCCTTTGAACGTAGTACAA
CAGCCTGTTGCTGCATCGTCAGTGCCTTCCTACATGCCCCCACTGAATGC
TGATGATGTTCTCCCTAGAGACCATCTGTCAGATGGAAGTTTCTCAGATA
CGTATCCAGACATTACAACGCAAGCGATCATCTTAATTTTCTTGGCCCTA
TCGCCTTTCCTGGTCATGTTGCTCACTTCGTATCTAAAGATTATCATTAC
TTTAGTCTTATTACGTAACGCCTTAGGAGTACAACAAACACCTCCCAGTC
AAGTCCTCAATGGGATTGCACTCATCCTATCTATTTATGTGATGTTCCCC
ACGGGAGTGGCTATGTATAAAGATGCTCGCAAGGAAATCGAAGCCAATAC
CATTCCTCAAAGCCTCTTCACTGCAGAAGGTGCTGAAACAGTGTTTGTCG
CTTTAAACAAATCTAAAGAACCTTTGCGCTCTTTCTTAATTCGCAACACT
CCAAAAGCACAAATTCAAAGCTTTTACAAGATCTCACAGAAAACCTTCCC
TTCGGAAATTCGAGCGCACCTCACTGCCTCCGACTTTGTAATCATTATTC
CTGCTTTTATTATGGGTCAGATAAAAAATGCTTTCGAAATTGGAGTCTTG
ATCTATCTACCTTTCTTTGTTATTGATTTAGTGACTGCTAACGTTCTTGT
AGCGATGCAGATGATGATGTTATCCCCTCTATCGATTTCGTTACCTTTAA
AGTTACTTTTGATCGTCATGGTAGACGGATGGACATTACTGCTCCAAGGG
CTTATGATCAGCTTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy