Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR649 IGR656 IGR657 IGR650 IGR653 IGR658 IGR654 IGR659 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0820 CPn0829 CPn0821 gspF, - CPn0817 gspE, - CPn0816 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0820 CPn0829 CPn0821 gspF, - CPn0817 gspE, - CPn0816 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0822 CPn0829 CPn0821 gspF, - CPn0817 gspE, - CPn0816 CPn0819 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0823

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yscT  sctT  

Definition:
YopT translocation protein (FliR or YscT-related)

Gene Start:
932367

Gene Stop:
931498

Gene Length:
870

Molecular Weight*:
32316

pI*:
7.00

Net Charge*:
0.09

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type III Secretion System

Secondary Evidence:
IRIARTE M, CORNELIS GR. 1998. "YOPT, A NEW YERSINIA YOP EFFECTOR PROTEIN, AFFECTS THE CYTOSKELETON OF HOST-CELLS." MOLECULAR MICROBIOLOGY 29(3): 915-929.

Comment:
In E.coli, the FliR protein is an integral membrane protein that has a
role in flagellar biosynthesis. The YscT protein in Yersinia is a
component of the YOP secretion machinery. See CPn0824, CPn0825, CPn0826 and CPn0828.

Blast Summary:  PSI-Blast Search
CPn0823 is orthologously related to CT564: residues 4-286 of CPn0823 are 74% similar to residues 3-285 of CT564, a predicted flagellar biosynthesis- YopT translocation protein (FliR or YscT-related) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1684
COG name: Flagellar biosynthetic protein FliR
Functional Class:  N
The phylogenetic pattern of COG1684 is -----qv-eb--uj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 270 (E-value = 4.2e-10) place CPn0823 in the Bac_export_1 family which is described as Bacterial export proteins, family 1 (PF01311)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
26  
50
transmembrane  
55  
74
transmembrane  
91  
114
transmembrane  
148  
170
transmembrane  
186  
210
transmembrane  
217  
241
transmembrane  
250  
270

PDB Hit:


Gene Protein Sequence:
MGISLPELFSNLGSAYLDYIFQHPPAYVWSVFLLLLARLLPIFAVAPFLG
AKLFPSPIKIGISLSWLAIIFPKVLADTQITNYMDNNLFYVLLVKEMIIG
IVIGFVLAFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGILYH
YFVTIIFWLVGGHRIVISLLLQTLEVIPIHSFFPAEMMSLSAPIWITMIK
MCQLCLVMTIQLSAPAALAMLMSDLFLGIINRMAPQVQVIYLLSALKAFM
GLLFLTLAWWFIIKQIDYFTLAWFKEVPIMLLGSNPQVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAATCTCTCTACCAGAGCTTTTTTCCAACCTAGGTTCTGCTTACTT
AGATTATATCTTTCAACATCCTCCGGCCTATGTTTGGTCAGTTTTTCTTC
TTTTATTAGCCCGTCTGCTTCCTATTTTTGCTGTAGCTCCCTTCTTAGGA
GCAAAGCTCTTTCCCTCCCCTATTAAAATCGGGATTAGTCTCTCTTGGCT
TGCAATCATCTTTCCAAAAGTCTTGGCGGATACGCAGATCACAAATTACA
TGGATAACAATCTCTTTTATGTTTTACTTGTGAAGGAGATGATCATAGGC
ATTGTGATAGGCTTTGTTTTAGCATTTCCCTTTTATGCTGCACAATCGGC
AGGATCTTTCATCACTAACCAACAAGGGATTCAGGGTTTAGAGGGCGCGA
CATCCCTGATTTCCATTGAGCAGACCTCTCCGCATGGCATTTTATACCAT
TACTTCGTGACTATTATTTTTTGGTTAGTGGGTGGTCACCGTATTGTAAT
CTCTTTGTTATTGCAAACTCTTGAAGTCATTCCGATCCATAGTTTCTTTC
CTGCCGAGATGATGAGCTTAAGTGCCCCGATTTGGATTACTATGATCAAG
ATGTGCCAGCTCTGTCTCGTGATGACCATACAGCTGAGTGCTCCTGCAGC
TTTGGCGATGTTAATGTCCGACCTATTCTTAGGGATTATTAACCGTATGG
CACCTCAAGTTCAGGTCATCTACCTCCTCTCTGCCCTTAAGGCTTTCATG
GGTCTTCTCTTTCTCACCCTGGCGTGGTGGTTCATAATTAAGCAGATAGA
TTATTTCACTCTTGCTTGGTTCAAAGAAGTCCCCATTATGCTCCTAGGTT
CCAACCCTCAAGTACTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy