Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR649 IGR656 IGR657 IGR650 IGR653 IGR658 IGR654 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspE, - CPn0816 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspE, - CPn0816 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 CPn0827 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 yscJ,sctJ, - CPn0828 CPn0822 CPn0821 gspF, - CPn0817 gspE, - CPn0816 CPn0819 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0822

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
930756

Gene Stop:
931232

Gene Length:
477

Molecular Weight*:
17163

pI*:
8.40

Net Charge*:
5.81

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT565, a Chlamydia-specific hypothetical protein. Residues 1-147 are 56% similar to CT565.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
51  
75
transmembrane  
105  
129

PDB Hit:


Gene Protein Sequence:
MADETPKENSSKESSSQFDSLKRKVKDLHSNPKVGKWKKFLSHRACEAIG
GCLVLVGIIADFISWAGGLFIACGVVLGFHVEIRKMLSNLQSYSIANGPI
KNAILCGLILFFVLNIPSFAVSFIVLCVILSFITTAPSCSTCSKDHCDKH
QDTSNKPS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGACGAGACCCCGAAAGAGAACTCCTCCAAAGAATCGTCCTCACA
ATTTGACTCTTTGAAGCGTAAGGTGAAAGATTTACACTCCAATCCTAAAG
TAGGGAAATGGAAGAAGTTTCTTTCTCATCGAGCTTGCGAAGCTATCGGT
GGTTGCTTGGTGCTGGTTGGTATCATCGCTGATTTTATTTCATGGGCTGG
AGGACTGTTTATTGCTTGTGGTGTGGTCCTAGGTTTTCACGTTGAAATTC
GTAAAATGCTTAGCAATCTCCAGAGCTATTCGATTGCTAATGGCCCTATT
AAGAATGCAATTCTCTGTGGCTTGATTTTATTTTTTGTATTAAACATCCC
TTCCTTTGCAGTCTCGTTTATTGTTCTCTGTGTCATTCTTTCTTTTATTA
CAACAGCACCGTCATGTTCGACGTGTTCGAAAGATCATTGTGACAAACAT
CAAGATACTTCTAATAAACCTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy