Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR649 IGR656 IGR657 IGR650 IGR653 IGR658 IGR654 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspD, - CPn0815 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspD, - CPn0815 sctS,yscS,fliQ, - CPn0824 yscL,sctL, - CPn0826 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0822 CPn0821 gspF, - CPn0817 gspD, - CPn0815 CPn0819 gspE, - CPn0816 gspE, - CPn0816 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0820

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
929120

Gene Stop:
929662

Gene Length:
543

Molecular Weight*:
21052

pI*:
10.50

Net Charge*:
10.86

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT567, a Chlamydia-specific hypothetical protein. Residues 9-180 are 40% similar to CT567.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 180 (E-value = 5.2e-135) place CPn0820 in the DUF1494 family which is described as Protein of unknown function (DUF1494) (PF07379)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
27

PDB Hit:


Gene Protein Sequence:
MCNSIAMKKQKRGFVLMELLMSFTLIALLLGTLGFWYRKIYTVQKQKERI
YNFYIEESRAYKQLRTLFSMSLSSSYEEPGSLFSLIFDRGVYRDPKLAGA
VRASLHHDTKDQRLELRICNIKDQSYFETQRLLSHVTHVVLSFQRNPDPE
KLPETIALTITREPKAYPPRTLTYQFAVGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTAACTCTATAGCTATGAAAAAGCAAAAGCGTGGCTTTGTGCTTAT
GGAATTACTCATGTCGTTCACTCTAATTGCTTTGTTATTAGGGACTTTAG
GATTTTGGTATCGGAAAATTTATACTGTACAAAAGCAAAAAGAACGTATT
TATAACTTTTATATCGAAGAAAGCCGAGCCTACAAGCAGCTCAGAACCCT
GTTTAGCATGTCCTTGTCTTCATCTTACGAGGAGCCTGGATCATTATTTT
CTTTAATCTTTGATCGGGGTGTTTATCGAGATCCTAAGCTGGCAGGTGCG
GTACGAGCTTCTCTCCATCATGACACCAAGGATCAGAGATTGGAACTTCG
TATTTGTAATATTAAGGATCAGTCTTACTTTGAAACACAGCGACTGCTCT
CCCACGTGACCCATGTTGTACTTTCCTTCCAGAGAAATCCTGATCCTGAA
AAACTTCCTGAAACAATTGCTTTAACTATAACACGGGAACCTAAAGCATA
TCCTCCAAGGACGTTAACATACCAATTTGCGGTTGGGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy