Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR649 IGR656 IGR650 IGR653 IGR654 sctS,yscS,fliQ, - CPn0824 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspD, - CPn0815 sctS,yscS,fliQ, - CPn0824 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 gspD, - CPn0815 sctS,yscS,fliQ, - CPn0824 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0822 CPn0821 gspF, - CPn0817 gspD, - CPn0815 CPn0819 gspE, - CPn0816 gspE, - CPn0816 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0818

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
928314

Gene Stop:
928685

Gene Length:
372

Molecular Weight*:
13829

pI*:
9.90

Net Charge*:
5.38

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0818 is orthologously related to CT569: residues 15-122 of CPn0818 are 73% similar to residues 1-108 of CT569, a predicted Chlamydia-specific hypothetical protein. No significant similarity to T. pallidum, M. genitalium, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2165
COG name: General secretion pathway protein G
Functional Class:  N
The phylogenetic pattern of COG2165 is -----q--e---------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKRQKRKQSITLIEMMVVITLIGIIGGALAFNMRGSIHKGKVFQSEQNCA
KVYDILMMEYATGGSSLKEIIAHKETVVEEASWCKEGRKLLKDAWGEDLI
VQLNDKGDDLVIFSKRVQSSNKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGACAAAAGAGAAAGCAGTCCATCACATTGATTGAGATGATGGT
TGTAATCACCCTCATAGGGATTATTGGTGGTGCTTTAGCATTCAATATGC
GAGGCAGTATCCATAAAGGTAAGGTATTTCAATCTGAGCAAAATTGTGCG
AAAGTATACGACATCTTGATGATGGAGTATGCCACGGGGGGATCTTCGTT
AAAGGAAATCATTGCTCATAAGGAGACAGTTGTCGAAGAGGCTTCTTGGT
GTAAAGAGGGTAGGAAATTACTTAAAGACGCTTGGGGAGAAGATCTGATT
GTGCAACTTAATGATAAGGGTGATGATTTAGTCATCTTCTCTAAGCGTGT
ACAAAGTTCAAATAAGAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy