Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR655 IGR649 IGR656 IGR650 IGR653 IGR654 sctS,yscS,fliQ, - CPn0824 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 CPn0814 gspD, - CPn0815 sctS,yscS,fliQ, - CPn0824 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 CPn0818 CPn0822 CPn0820 CPn0821 gspF, - CPn0817 CPn0814 gspD, - CPn0815 yscT,sctT, - CPn0823 sctR,yscR, - CPn0825 sctS,yscS,fliQ, - CPn0824 CPn0822 CPn0821 gspF, - CPn0817 CPn0814 gspD, - CPn0815 CPn0819 gspE, - CPn0816 gspE, - CPn0816 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0817

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gspF  

Definition:
type II secretion pathway protein (protein F).

Gene Start:
927115

Gene Stop:
928290

Gene Length:
1176

Molecular Weight*:
43355

pI*:
8.50

Net Charge*:
6.13

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to general secretion protein F sequences; e.g. residues 1-386 are 25% similar to GSPF_PSEAE; residues 4-384 are 24% similar to GSPF_ECOLI; and residues 1-384 are 24% similar to GSPF_ERWCA.

CPn0817 is orthologously related to CT570: residues 1-390 of CPn0817 are 54% similar to residues 1-390 of CT570, a predicted type II secretion pathway protein (protein F) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1459
COG name: General secretion pathway protein F
Functional Class:  N
The phylogenetic pattern of COG1459 is -----QvcEb-h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 60-345 span five regions of similarity to blocks BL00874A-D (Bacterial type II secretion system protein F proteins) with a combined E-value of 4.2e-23.

ProDom Summary:  Protein Domain Search
Residues 18-136 are 36% similar to a defined domain of Q57076_NEIGO, defined as: PROTEIN TRANSPORT TRANSMEMBRANE INNER MEMBRANE SECRETION ASSEMBLY GENERAL PATHWAY F.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 58 to 183 (E-value = 7.1e-21) place CPn0817 in the GSPII_F family which is described as Bacterial type II secretion system protein F domain (PF00482)
Residues 259 to 383 (E-value = 3.8e-21) place CPn0817 in the GSPII_F family which is described as Bacterial type II secretion system protein F domain (PF00482)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
55  
72
transmembrane  
162  
179
transmembrane  
206  
228
transmembrane  
251  
268
transmembrane  
362  
383

PDB Hit:


Gene Protein Sequence:
MPRYRYTYLDPKERRKRGYLEALHIQEAREKLAQENIQVLDIREVALRRM
SIKSTELIVFTKQLLLLLRSGLPLYESLVSLRDQYHEQKMGLLLTSFMET
LRSGGSLSQAMAAHPNIFDHFYCSGVAAGESVGNLEGCLQNIIVVLEERA
QITKKMVGALSYPCVLLVFSFAVMLFFLLGVIPSLKETFENMEVKGLTKI
VFGVSDCLSAYRYLFLGFASALITVGILMRHRIPWKKILEKLLFALPGTK
KFVVKVAVNRFCSVASAILKGGGTLIEGLDLGCDAIPYDRLKTDMRDIVQ
AVIGGGSLSQELAQRSWVPKLAIGMIALGEESGDLADVLGYVAHIYNEDT
QKTLASITSWCQPVILIFLGGLIGVIMLAILIPLTSNIQTL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTCGATATCGGTATACATATTTAGATCCCAAAGAGCGAAGGAAACG
AGGATATTTGGAAGCCCTTCATATACAAGAAGCTAGAGAAAAGCTCGCCC
AGGAAAATATCCAAGTTTTGGATATTCGTGAGGTCGCCTTACGAAGAATG
AGCATTAAAAGTACCGAGCTCATCGTGTTTACAAAACAGCTCCTCCTCCT
CCTACGCTCTGGACTGCCGCTATATGAAAGCTTGGTATCTCTCCGAGATC
AGTATCATGAGCAGAAAATGGGACTTTTGCTCACATCGTTTATGGAAACT
CTAAGATCGGGTGGGTCTTTATCTCAAGCTATGGCAGCACATCCGAATAT
CTTTGATCACTTTTATTGTAGTGGTGTCGCTGCTGGAGAAAGTGTGGGGA
ATCTCGAAGGGTGTCTGCAAAATATTATTGTTGTTCTGGAAGAGCGTGCG
CAGATTACCAAGAAGATGGTCGGCGCATTAAGTTATCCTTGTGTGTTGTT
AGTATTTTCTTTTGCCGTGATGCTTTTCTTTTTGTTAGGAGTGATCCCTT
CATTAAAAGAGACCTTTGAAAATATGGAAGTCAAAGGACTAACAAAAATT
GTTTTTGGAGTTAGCGACTGTCTCTCCGCATACCGGTATCTATTTTTAGG
ATTTGCGAGTGCTTTGATTACCGTTGGAATTTTGATGCGCCATCGCATTC
CCTGGAAAAAGATCCTAGAGAAGCTCTTATTTGCTTTGCCAGGAACCAAG
AAGTTTGTTGTTAAGGTAGCGGTGAATCGGTTTTGTTCCGTGGCATCGGC
AATCTTGAAGGGAGGGGGGACCCTAATCGAAGGTCTCGACTTGGGGTGTG
ACGCAATTCCCTATGACAGACTGAAGACCGATATGAGAGATATTGTTCAG
GCTGTAATCGGTGGGGGATCTTTAAGTCAGGAGCTTGCTCAGCGCTCTTG
GGTTCCCAAGCTCGCTATAGGGATGATTGCTTTGGGAGAAGAGTCGGGGG
ATCTTGCCGACGTTTTAGGATATGTAGCCCACATTTATAATGAGGATACA
CAAAAAACGTTGGCTTCGATAACGTCGTGGTGTCAACCCGTGATTCTGAT
TTTTCTTGGTGGCCTGATCGGTGTGATCATGTTGGCAATATTGATCCCAC
TCACAAGCAATATCCAAACATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy