Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR649 IGR650 IGR653 IGR647 IGR654 CPn0818 CPn0822 CPn0820 CPn0821 pepP, - CPn0813 gspF, - CPn0817 CPn0814 gspD, - CPn0815 CPn0818 CPn0822 CPn0820 CPn0821 pepP, - CPn0813 gspF, - CPn0817 CPn0814 gspD, - CPn0815 CPn0822 CPn0821 pepP, - CPn0813 gspF, - CPn0817 CPn0814 gspD, - CPn0815 CPn0819 gspE, - CPn0816 gspE, - CPn0816 CPn0818 CPn0820 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0816

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gspE  

Definition:
general secretion pathway protein type E-related (GSPE)

Gene Start:
925615

Gene Stop:
927105

Gene Length:
1491

Molecular Weight*:
55417

pI*:
6.40

Net Charge*:
-5.67

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:
In P.aeruginosa, this protein serves as a general secretion pathway ATPase required for translocation of proteins across the outer membrane. In PSEAE it is called a type II traffic warden ATPase.
See CT571.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to general secretion pathway protein E sequences; e.g. residues 8-496 are 69% similar to CT571; residues 28-493 are 44% similar to (AE000742) general secretion pathway protein E [Aquifex aeolicus]; residues 1-493 are 43% similar to GSPE_VIBCH; and residues 112-493 are 52% similar to GSPE_PSEAE.
No significant similarity to M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0630
COG name: Predicted ATPases involved in pili biogenesis
Functional Class:  N
The phylogenetic pattern of COG0630 is AMtK-QVCEbrhUJ----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 117-449 span eight regions of similarity to blocks BL00662A-H (Bacterial type II secretion system protein E proteins) with a combined E-value of 6e-132.

ProDom Summary:  Protein Domain Search
Residues 246-360 are 72% similar to a defined domain of O67452_AQUAE, defined as: PROTEIN TRANSPORT ATP-BINDING PLASMID SECRETION TYPE II GENERAL PATHWAY E.
Residues 112-222 are 54% similar to a defined domain of GSPE_XANCP, defined as: PROTEIN TRANSPORT SECRETION ATP-BINDING TYPE GENERAL PATHWAY E II TRAFFIC.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 108 to 386 (E-value = 2.5e-115) place CPn0816 in the GSPII_E family which is described as Type II/IV secretion system protein (PF00437)

PDB Hit:


Gene Protein Sequence:
MAASILSQELLDILPYTFLKKHCLLPIEESSEAITIAHATATSVIAQDEV
KLLIKKPVRFVLKEESEILQRLQQLYSNREGNVSDMLLTMKEEDGTTISE
EEDLLETTDTIPVVRLLNWILKEAIEERASDIHFEPCEDSMRIRYRIDGV
LHDRHSPPSHLRSALTTRLKVLAKMDIAEHRLPQDGRIKIHIGGQEVDMR
VSTVPVIYGERVVLRILDKRNVILDIAGLHMPKGTEILFKDTITAPEGIL
LVTGPTGSGKTTTLYSVLQELKGPLTNIMTIEDPPEYKLPGIAQIAVKPK
IGLTFARGLRHLLRQDPDILMVGEIRDQETAEIAIQAALTGHLVVSTLHT
NDAISAIPRLLDMGIESYLLSATLVGVVAQRLVRTICPYCKVAYTPENQE
KSFLASLGKDTEMPLYRGQGCVHCFRSGYKGRQGIYEFLRPNTLFRSEVA
SNRPYHILRETAEQNGFLPILEHGIALAVSGETTLAEVLRVTKRCD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGCTAGTATTTTATCTCAGGAGCTTTTGGATATCCTTCCTTATAC
TTTTTTAAAGAAACACTGTCTTCTCCCTATTGAAGAGAGTAGTGAGGCTA
TTACTATAGCCCATGCTACCGCGACTTCAGTCATTGCTCAAGATGAAGTC
AAATTGTTAATAAAAAAGCCTGTGCGTTTCGTTCTAAAAGAGGAATCGGA
GATTCTGCAGCGCTTACAGCAGCTCTACAGCAATCGGGAAGGTAATGTTT
CCGATATGTTGTTAACAATGAAAGAGGAAGATGGCACTACGATTTCGGAA
GAAGAAGATCTTCTGGAGACTACGGATACGATCCCAGTCGTACGCTTGTT
GAACTGGATTCTGAAAGAAGCGATTGAAGAGCGCGCTTCGGACATTCATT
TTGAGCCTTGTGAGGATTCTATGAGAATCCGCTACCGCATTGATGGTGTG
CTTCACGATCGTCATTCCCCACCTTCCCACCTGCGTTCGGCATTAACCAC
TCGGCTTAAAGTCCTCGCAAAGATGGATATTGCGGAGCACCGTCTTCCTC
AAGACGGGCGTATTAAGATCCATATTGGTGGTCAGGAAGTGGACATGCGT
GTCAGCACGGTTCCCGTGATTTATGGCGAGCGTGTTGTTCTTCGTATTTT
AGATAAGCGCAATGTCATTTTGGATATCGCGGGCTTGCATATGCCTAAGG
GTACCGAAATACTCTTTAAAGATACCATAACAGCTCCTGAAGGGATCCTT
CTGGTTACAGGACCTACAGGCAGTGGGAAAACTACGACCCTCTACAGTGT
ATTACAAGAGCTTAAGGGACCTTTAACAAATATCATGACGATCGAAGATC
CTCCAGAGTATAAACTGCCTGGAATTGCTCAGATTGCTGTGAAGCCTAAA
ATTGGGCTGACTTTCGCACGAGGGTTACGGCATTTACTGCGTCAAGATCC
CGATATCCTTATGGTCGGAGAAATCCGAGATCAGGAAACTGCAGAAATCG
CAATACAAGCAGCATTGACTGGGCATTTGGTAGTGAGCACGCTCCATACG
AATGACGCTATTTCTGCGATTCCCCGTCTTCTGGATATGGGGATAGAATC
CTATTTGTTATCGGCAACGCTCGTTGGCGTGGTTGCCCAGAGGCTGGTGC
GAACCATTTGTCCCTATTGTAAGGTCGCTTATACTCCTGAGAATCAGGAA
AAATCTTTTCTAGCTTCTCTAGGGAAAGATACAGAAATGCCTTTATATCG
GGGGCAAGGGTGCGTGCATTGTTTCCGTTCCGGATATAAAGGAAGACAGG
GAATTTACGAATTTTTACGCCCGAATACACTATTTCGTTCAGAAGTAGCC
TCAAACCGCCCCTATCATATTTTACGAGAAACTGCAGAACAAAACGGATT
CTTACCGATCTTAGAGCACGGCATCGCTCTTGCTGTATCTGGTGAGACTA
CCTTAGCAGAAGTCTTAAGAGTTACCAAGCGCTGTGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy