Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR651 IGR646 IGR649 IGR650 IGR647 CPn0818 CPn0820 pepP, - CPn0813 gspF, - CPn0817 CPn0814 mutL, - CPn0812 gspD, - CPn0815 CPn0818 CPn0820 pepP, - CPn0813 gspF, - CPn0817 CPn0814 mutL, - CPn0812 gspD, - CPn0815 pepP, - CPn0813 gspF, - CPn0817 CPn0814 mutL, - CPn0812 gspD, - CPn0815 CPn0819 gspE, - CPn0816 gspE, - CPn0816 CPn0820 CPn0818 CPn0819
* Calculated from Protein Sequence

Gene ID: CPn0815

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gspD  

Definition:
type II secretion pathway protein (protein D)

Gene Start:
923361

Gene Stop:
925625

Gene Length:
2265

Molecular Weight*:
83515

pI*:
5.10

Net Charge*:
-20.43

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to General Secretion Protein D sequences; e.g. residues 16-753 are 62% similar to CT572; residues 257-692 are 22% similar to GSPD_AERHY; residues 224-698 are 23% similar to GSQD_ERWCH; and residues 241-692 are 20% similar to GSPD_ECOLI.
No significant similarity to M.genitalium, T.pallidum, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1450
COG name: General secretion pathway protein D
Functional Class:  N
The phylogenetic pattern of COG1450 is -----QVcE--h------IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 453-484, 529-564, and 629-670 represent blocks BL00875A-C (Bacterial type II secretion system protein D proteins) with a combined E-value of 2e-19.

ProDom Summary:  Protein Domain Search
Residues 449-690 are 27% similar to a defined domain of Q44076_AERHY, defined as: PROTEIN TRANSPORT PRECURSOR OUTER MEMBRANE SIGNAL SECRETION D GENERAL PATHWAY.

Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 283 to 356 (E-value = 1.3e-05) place CPn0815 in the Secretin_N family which is described as Bacterial type II/III secretion system short domain (PF03958)
Residues 362 to 462 (E-value = 6e-14) place CPn0815 in the Secretin_N family which is described as Bacterial type II/III secretion system short domain (PF03958)
Residues 464 to 691 (E-value = 2e-63) place CPn0815 in the Secretin_C family which is described as Bacterial type II and III secretion system protein (PF00263)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
25
coil-coil  
48  
75
non-globular  
77  
144
non-globular  
690  
754

PDB Hit:


Gene Protein Sequence:
MVFFRNSLLHLVALSGMLCCSSGVALTIAEKMASLEHSGRGADDYEGMAS
FNANMREYSLQLSKLYEEARKLRASGTEDEALWKDLIRRIGEVRGYLREI
EELWAAEIREKGGNLEDYALWNHPETTIYNLVTDYGTEDSIYLIPQEIGA
IKIATLSKFVVPKESFEDCLTQILSRLGIGVRQVNSWIKELYMMRKEGCS
VAGVFSSRKDLEALPETAYIGFVLNSNVDAHTNQHVLKKFINPETTHVDV
IAGRVWIFGSAGEVGELLKIYNFVQSESIRQEYRVIPLTKIDPGEMISIL
NAAFREDLTKDVSEESLGLRVVPLQYQGRSLFLSGTAALVQQALTLIREL
EEGIENPTDKTVFWYNVKHSDPQELAALLSQVHDVFSGENKASVGAADGC
GSQLNASIQIDTTVSSSAKDGSVKYGNFIADSKTGTLIMVVEKEVLPRIQ
MLLKKLDVPKKMVRIEVLLFERKLAHEQKSGLNLLRLGEEVCKKGCSPSV
SWAGGTGILEFLFKGSTGSSIVPGYDLAYQFLMAQEDVRINASPSVVTMN
QTPARIAVVDEMSIAVSSDKDKAQYNRAQYGIMIKMLPVINVGEEDGKSY
ITLETDITFDTTGKNHDDRPDVTRRNITNKVRIADGETVIIGGLRCKQMS
DSHDGIPFLGDIPGIGKLFGMSSTSDSLTEMFVFITPKILENPVEQQERK
EEALLSSRPGEREEYYQALAASEAAARAAHKKLEMFPASGVSLSQVERQE
YDGC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTTTTCCGTAATTCTTTACTGCATTTAGTTGCCCTATCCGGAAT
GCTCTGTTGTTCTTCTGGAGTGGCTTTAACGATAGCCGAGAAGATGGCTT
CTTTAGAGCACTCGGGGAGAGGAGCAGACGATTATGAGGGGATGGCTTCG
TTTAATGCCAATATGAGGGAGTATAGCCTTCAGCTGAGCAAGTTGTATGA
GGAAGCACGAAAGCTACGCGCTTCTGGAACTGAGGATGAAGCTCTGTGGA
AGGACTTAATTCGACGGATTGGTGAGGTGCGAGGCTATCTTCGAGAGATC
GAGGAGCTTTGGGCTGCAGAAATTCGTGAGAAAGGGGGCAATCTCGAGGA
CTACGCCCTCTGGAATCACCCAGAGACTACGATTTACAATCTTGTTACCG
ATTACGGAACCGAAGACTCTATTTATTTGATTCCTCAAGAAATCGGAGCG
ATTAAAATCGCAACCTTATCGAAATTTGTAGTTCCTAAAGAGTCTTTCGA
AGACTGTCTCACTCAGATCCTATCTCGCTTAGGTATTGGCGTGCGTCAGG
TCAATTCTTGGATTAAGGAACTTTATATGATGCGTAAGGAGGGCTGCAGT
GTTGCTGGAGTTTTTTCCTCCAGAAAAGATTTAGAGGCGCTCCCAGAAAC
AGCCTATATTGGTTTTGTATTGAATTCGAACGTAGATGCGCATACCAATC
AACATGTCTTAAAAAAGTTCATTAACCCTGAAACAACGCATGTAGATGTG
ATTGCAGGACGTGTGTGGATTTTTGGTTCTGCGGGGGAAGTCGGCGAGCT
TCTGAAGATTTATAATTTTGTGCAGTCGGAGAGCATACGTCAAGAGTATC
GGGTGATTCCCTTAACTAAGATCGATCCAGGGGAGATGATTTCCATTCTC
AACGCAGCATTTCGTGAGGATCTGACTAAAGATGTTAGTGAAGAATCTTT
AGGCCTTCGTGTAGTTCCTTTACAGTATCAAGGGCGTTCGTTGTTTTTAA
GTGGAACCGCGGCGTTAGTGCAGCAAGCGCTGACTCTCATTCGAGAGCTT
GAAGAAGGGATTGAGAACCCTACGGATAAAACAGTATTTTGGTATAACGT
CAAGCACTCCGATCCCCAAGAGTTGGCGGCATTGCTTTCCCAAGTCCATG
ATGTCTTCTCTGGCGAGAATAAGGCGAGTGTCGGAGCTGCAGATGGATGT
GGGTCGCAATTAAATGCCTCGATCCAAATTGATACTACAGTAAGTTCTTC
TGCGAAAGATGGCTCAGTGAAGTACGGAAACTTCATCGCGGATTCTAAGA
CAGGAACTCTGATTATGGTGGTTGAGAAAGAAGTTCTTCCACGTATTCAG
ATGCTACTTAAGAAACTAGATGTCCCTAAAAAGATGGTCCGTATCGAGGT
GCTGTTATTTGAAAGAAAATTGGCACATGAGCAGAAATCTGGGTTAAATC
TTCTACGTCTTGGTGAGGAAGTTTGTAAAAAAGGGTGCAGTCCTTCTGTG
TCTTGGGCCGGGGGTACTGGCATACTAGAATTTTTATTTAAAGGAAGTAC
GGGATCTTCGATAGTTCCTGGTTATGATCTCGCCTATCAATTTTTAATGG
CTCAAGAGGACGTTCGGATTAATGCGAGTCCTTCTGTAGTTACTATGAAC
CAAACCCCAGCACGGATTGCTGTTGTTGATGAAATGTCAATAGCGGTGTC
TTCAGATAAAGATAAAGCGCAATACAATCGTGCGCAGTACGGTATCATGA
TAAAAATGCTCCCCGTAATTAATGTGGGAGAGGAAGACGGAAAAAGTTAC
ATTACTTTAGAGACAGACATCACCTTTGATACTACGGGAAAAAATCATGA
TGATCGTCCTGATGTTACAAGGCGTAATATTACTAATAAGGTGCGCATTG
CTGACGGAGAGACTGTGATTATTGGAGGTTTGCGTTGCAAACAGATGTCA
GATTCTCATGATGGCATTCCTTTCCTTGGAGACATTCCTGGTATAGGGAA
GTTATTTGGAATGAGTTCCACATCAGACAGTCTCACGGAGATGTTTGTAT
TTATCACTCCGAAGATCCTAGAAAATCCTGTAGAGCAACAAGAACGTAAA
GAAGAAGCTTTACTCTCTTCGCGCCCTGGAGAGAGAGAAGAATACTATCA
GGCTTTAGCAGCTAGTGAGGCTGCAGCACGAGCAGCTCATAAAAAATTAG
AGATGTTCCCGGCATCAGGAGTATCTTTATCTCAGGTAGAGAGGCAAGAA
TACGATGGCTGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy