Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR646 IGR644 IGR643 IGR647 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0809 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 CPn0810 lcrH_1, - CPn0811 CPn0809 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 lcrH_1, - CPn0811 CPn0809 CPn0810 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 gspE, - CPn0816 gspE, - CPn0816
* Calculated from Protein Sequence

Gene ID: CPn0813

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepP  

Definition:
aminopeptidase P

Gene Start:
920870

Gene Stop:
921937

Gene Length:
1068

Molecular Weight*:
39979

pI*:
6.30

Net Charge*:
-5.94

EC:
3.4.11.9  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Secondary Evidence:
Yoshimoto, T., H. Tone, T. Honda, K. Osatomi, R. Kobayashi, D. Tsuru. 1989. "Sequencing and high expression of aminopeptidase P gene from Escherichia coli HB101." J.Biochem.(Tokyo) 105:412-416.

Comment:
Aminopeptidase PII releases any N-terminal amino acid, including proline, that is linked with proline, even from a dipeptide or tripeptide.
Its cofactor is zince but the inactive apoenzyme can be activated by the addition of manganese as well as zinc.
Aminopeptidase PII is a homotetramer belonging to peptidase family M24B.

Blast Summary:  PSI-Blast Search
CPn0813 is orthologously related to CT574: residues 1-355 of CPn0555 are 52% similar to residues 1-356 of CT574, a predicted XAA-PRO aminopeptidase from C .trachomatis.
CPn0813 is also similar to UU532, MG324 and slightly similar to TP0842, all aminopeptidases.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0006
COG name: Xaa-Pro aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0006 is amtKYqvcEBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0813 is slightly paralogous to CPn1009: residues 127-317 of CPn0813 are 26% similar to residues 43-242 of CPn1009, a predicted methionine aminopeptidase from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 282 to 342 (E-value = 6.5e-18) place CPn0813 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:


Gene Protein Sequence:
MSHDRILRAQRALSEHNLDAILVEKSEDLAYFLHDEAIAGILLIGQQEVM
FFVYRMDKDLYSHIQRVPLTFLTQDVVADLSLYVQKQRYQKIGFDSASTV
YHKFAQRQVLPCLWEPLECFTEKIRSIKSEEEIRRMQEAAALGSAGYDYV
LTLLREGITEKEVVRQLRAFWAEAGAEGPSFPPIIAFGEHSAFPHSIPTD
RPLKKGDIVLIDIGVLLNGYCSDMTRMTALGTPHPKLLESYPVVVEAQKR
AMALCKEGVLWGDIDAEAVRVLREHHLDTYFIHGIGHGVGRHIHEYPCSP
RGSQVKLESGMTITVEPGVYFPGIGGIRIEDTLCIDKNKNFSLTARPVIS
ELVCL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACACGATCGTATTTTACGTGCTCAAAGAGCCCTCTCAGAACATAA
TCTTGATGCTATTCTTGTGGAAAAAAGCGAAGATCTTGCTTATTTCCTGC
ATGATGAAGCGATTGCAGGGATCTTATTGATAGGGCAGCAAGAAGTGATG
TTCTTTGTCTACAGAATGGATAAGGACCTCTATTCTCATATCCAACGTGT
GCCTTTGACTTTTCTCACTCAGGATGTTGTTGCAGACTTATCGCTCTACG
TACAAAAACAGAGGTATCAGAAAATAGGATTTGATAGTGCCTCAACAGTG
TATCACAAGTTTGCACAGAGGCAAGTACTTCCCTGTCTTTGGGAGCCTTT
AGAGTGCTTCACAGAGAAAATTCGTAGTATAAAATCTGAAGAAGAAATTA
GACGCATGCAAGAAGCTGCAGCTTTGGGATCCGCAGGATATGATTACGTA
TTGACGTTACTTCGAGAGGGAATCACAGAGAAAGAGGTCGTGAGACAGCT
GCGAGCTTTCTGGGCTGAGGCAGGAGCCGAAGGACCTTCTTTTCCTCCCA
TTATTGCTTTTGGAGAGCATTCAGCGTTTCCACACTCGATCCCTACAGAC
CGTCCTTTAAAGAAAGGAGATATTGTTCTTATTGATATTGGAGTTCTTCT
GAACGGGTATTGTTCTGATATGACCCGGATGACGGCATTAGGAACTCCGC
ATCCTAAGCTTTTGGAAAGCTATCCTGTGGTTGTGGAAGCTCAAAAGCGC
GCCATGGCTCTTTGCAAAGAAGGAGTGCTTTGGGGAGACATTGATGCAGA
AGCTGTGCGTGTACTGCGAGAGCATCACCTGGATACTTATTTTATCCATG
GAATAGGACACGGGGTGGGGAGACATATTCATGAGTACCCTTGTTCTCCG
CGGGGAAGTCAGGTGAAACTGGAATCTGGCATGACCATTACTGTGGAGCC
AGGGGTCTATTTTCCTGGGATTGGTGGGATTCGCATCGAGGACACCCTAT
GTATAGATAAAAATAAAAATTTTAGTTTGACTGCACGTCCTGTAATCTCA
GAGTTAGTTTGTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy