Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR646 IGR642 IGR644 IGR643 IGR647 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 lcrH_1, - CPn0811 CPn0808 CPn0809 CPn0810 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815
* Calculated from Protein Sequence

Gene ID: CPn0812

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mutL  

Definition:
DNA mismatch repair protein

Gene Start:
919123

Gene Stop:
920865

Gene Length:
1743

Molecular Weight*:
64992

pI*:
5.10

Net Charge*:
-19.74

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
CTPn0812 is required for DAM-Dependent
Methyl-Directed DNA mismatch repair.

From Prosite PDOC00057:

Mismatch repair contributes to the overall
fidelity of DNA replication. It involves the
correction of mismatched base pairs that have
been missed by the proofreading element of the
DNA polymerase complex. The sequence of some
proteins involved in mismatch repair in
different organisms have been found to be
evolutionary related.

Blast Summary:  PSI-Blast Search
CPn0812 is similar to TP0303, a predicted
DNA mismatch repair protein (MutL) in T. pallidum.
Residues 5-310 are 32% similar to residues 35-354
of TP0303.

CPn0812 is orthologously related to CT575:
residues 7-578 are 52% similar to residues
8-576 of CT575.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0323
COG name: DNA mismatch repair enzyme (predicted ATPase)
Functional Class:  L
The phylogenetic pattern of COG0323 is ----Yqvceb-h----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 216 to 329 (E-value = 4.9e-47) place CPn0812 in the DNA_mis_repair family which is described as DNA mismatch repair protein, C-terminal domain (PF01119)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
80

PDB Hit:


Gene Protein Sequence:
MSTRRPIQLLDPLTINQIAAGEVIENSVSVVKELIENSLDAGADEIEIET
LGGGQGAIIIRDNGCGFRAEDIPIALQRHATSKIREFSDIFSLNSFGFRG
EALPSIASISKMEIQSSIEGDEGVRTVIHGGDIVSCEPCARQLGTTVIVN
SLFYNVPVRRGFQKSMQSDRLGIRKLIENRILSTANIGWSWISEGHHEIQ
IAKQQGFQERVAYVMGDHFMQDALTIDKEANGVRIVGVLGSPSFHRPTRQ
GQKIFINDRPIESLFISKKVGDAYALLLPLHRYPVFVLKLYLPSSWCDFN
VHPQKIEARILKEELVGDCIKEAIVETLACPPGILCRTHQEIEESDSVPL
PMFRMLETSDVQEEESVEFDQNLFAYSSEDVSLEKQEYTSRGPKSQMDWI
YSSDVRFLTSLGRVVLAEDLEGVHIIFTAAARKHLFFLSLMQENSRMYQS
QALLIPLRLQVTPEEAFFFSHHGRTLCDLGIEISQVGPCVFSIESTPTVI
GEEELKEWLLLLAARGSTDINSEALTALMKETLTQATFSKHQHVFDVSWL
KLLWSVGKPEKGFDGARIRRLILDSDFMEG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTACAAGAAGGCCTATTCAGTTACTTGATCCCCTGACCATCAATCA
AATTGCTGCTGGTGAGGTCATTGAAAACTCCGTTTCTGTTGTTAAAGAAC
TGATTGAGAATTCCTTAGATGCTGGCGCCGATGAAATAGAAATCGAAACT
TTAGGAGGGGGACAAGGCGCAATCATTATCAGAGATAATGGTTGTGGCTT
CAGAGCCGAAGACATCCCCATTGCCCTCCAACGTCACGCCACTTCAAAAA
TAAGAGAATTCTCTGATATTTTTTCTTTAAATAGCTTTGGCTTTCGAGGC
GAGGCTCTACCCTCCATTGCCTCGATTTCTAAAATGGAAATACAATCTTC
CATTGAGGGGGACGAGGGTGTACGTACCGTAATTCATGGGGGAGACATCG
TTTCTTGTGAGCCCTGTGCTCGGCAACTAGGAACCACAGTGATTGTGAAC
TCCCTGTTTTATAATGTTCCTGTGCGTCGTGGATTCCAAAAGAGCATGCA
ATCGGATCGCTTAGGGATTCGCAAGCTGATAGAAAATCGGATTTTATCCA
CAGCAAACATAGGGTGGTCCTGGATTAGCGAGGGACATCATGAAATTCAG
ATTGCTAAGCAGCAAGGATTTCAAGAAAGAGTCGCTTATGTGATGGGAGA
CCACTTCATGCAGGATGCCCTCACCATAGATAAAGAGGCAAATGGTGTCC
GTATTGTAGGGGTGTTAGGGTCTCCCAGCTTCCACCGTCCCACACGTCAA
GGACAGAAAATCTTTATTAACGATCGCCCTATAGAGTCTTTATTTATTTC
TAAGAAGGTTGGGGACGCCTATGCCTTGCTTCTGCCTCTACACAGGTATC
CTGTTTTTGTGCTGAAGCTCTATCTTCCTTCGTCATGGTGTGATTTTAAT
GTCCACCCACAAAAAATAGAGGCTCGAATTCTTAAGGAAGAACTTGTTGG
AGATTGTATCAAAGAAGCTATCGTAGAGACTCTAGCATGTCCTCCTGGCA
TCTTATGTCGTACGCATCAAGAAATAGAAGAATCTGATTCGGTGCCCTTA
CCCATGTTTCGTATGTTGGAAACAAGCGATGTGCAAGAAGAAGAGAGTGT
AGAGTTTGATCAAAATCTTTTTGCATATAGTTCAGAAGATGTTTCCTTAG
AGAAACAAGAATATACATCTAGAGGACCTAAGTCCCAAATGGATTGGATA
TATTCTAGCGACGTTCGTTTTTTAACTTCTTTAGGTCGTGTGGTCCTGGC
TGAGGATCTTGAGGGTGTGCACATTATTTTTACAGCTGCAGCGCGAAAGC
ACCTGTTTTTTCTGTCTTTGATGCAAGAGAATTCTCGCATGTATCAATCA
CAAGCATTACTGATTCCTCTACGCCTTCAGGTGACTCCTGAGGAGGCTTT
TTTCTTCTCTCATCACGGAAGAACGTTATGCGACTTAGGAATAGAAATAT
CACAGGTAGGACCTTGTGTTTTCTCTATTGAAAGTACCCCCACTGTCATT
GGTGAAGAAGAGCTAAAAGAATGGTTATTGCTATTGGCAGCAAGGGGCTC
TACTGATATAAACTCAGAGGCTTTAACAGCATTGATGAAAGAAACTTTGA
CGCAGGCAACGTTTTCTAAACATCAGCATGTTTTTGATGTTTCCTGGCTC
AAATTGCTTTGGAGTGTAGGGAAACCTGAAAAAGGATTTGACGGTGCACG
AATTCGTCGGTTAATTTTAGACTCTGATTTTATGGAAGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy