Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR646 IGR642 IGR644 IGR643 IGR641 IGR647 IGR640 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0810 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812 gspD, - CPn0815
* Calculated from Protein Sequence

Gene ID: CPn0811

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lcrH_1  

Definition:
low calcium response locus H protein

Gene Start:
918900

Gene Stop:
918205

Gene Length:
696

Molecular Weight*:
25932

pI*:
9.60

Net Charge*:
6.58

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:
It is a low calcium response protein H that mediates the negative
regulation of the LcrGVH OPERON by ATP or Ca(2+).
Also acts as a modulator of the YOP operon expression.

Blast Summary:  PSI-Blast Search
Cpn0811 is orthologously related to CT576: residues 1-229 of CPn0811 are 68% similar to residues 1-232 of CT576, a predicted low calcium reponse locus H protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
207  
231

PDB Hit:


Gene Protein Sequence:
MSKPSPRNANQPQKPSASFNKKTRSRLAELAAQKKAKADDLEQVHPVPTE
EEIKKALGNIFEGLSNGLDLQQILGLSDYLLEEIYTVAYTFYSQGKYNEA
VGLFQLLAAAQPQNYKYMLGLSSCYHQLHLYNEAAFGFFLAFDAQPDNPI
PPYYIADSLLKLQQPEESNNFLDVTMDICGNNPEFKILKERCQIMKQSIE
KQMAGETKKAPTKKPAGKSKTTTNKKSGKKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAGCCCTCTCCTCGTAATGCCAATCAACCTCAAAAACCTTCAGC
CTCTTTCAATAAAAAAACGCGAAGCCGTCTAGCAGAGCTGGCTGCTCAAA
AGAAAGCAAAGGCTGATGACTTAGAACAAGTCCATCCCGTACCTACGGAA
GAAGAAATTAAAAAAGCTTTAGGCAATATCTTCGAAGGTCTTAGCAATGG
ACTAGACCTACAACAGATTCTAGGTCTCTCGGACTATCTCTTAGAGGAGA
TCTATACTGTAGCTTATACATTCTATTCTCAAGGGAAGTACAACGAAGCT
GTAGGACTCTTCCAGTTATTGGCAGCAGCACAACCTCAGAACTACAAGTA
TATGTTAGGGTTAAGCTCCTGCTACCACCAATTGCATTTATATAATGAAG
CGGCTTTTGGATTTTTCCTTGCTTTCGATGCTCAACCTGACAACCCAATT
CCTCCTTACTACATTGCTGATAGCTTATTGAAGCTACAGCAACCCGAAGA
ATCTAACAATTTCTTAGACGTCACCATGGATATCTGTGGGAATAACCCAG
AATTCAAAATCTTAAAAGAACGTTGCCAAATTATGAAACAGTCTATTGAG
AAGCAGATGGCTGGAGAAACTAAGAAAGCACCGACAAAAAAACCTGCGGG
AAAAAGCAAAACAACTACAAATAAGAAAAGCGGAAAGAAACGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy