Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR646 IGR642 IGR644 IGR643 IGR641 IGR647 IGR640 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0810 CPn0807 pepP, - CPn0813 CPn0814 mutL, - CPn0812
* Calculated from Protein Sequence

Gene ID: CPn0810

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
918184

Gene Stop:
917822

Gene Length:
363

Molecular Weight*:
13026

pI*:
9.00

Net Charge*:
1.47

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT577, a hypothetical protein sequence. Residues 1-115 are 38% similar to CT577.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
120

PDB Hit:


Gene Protein Sequence:
MNKKPKKTKKAVQSKAAPVKRVPEESQEAAIQQLELAVSDLYKELPLAQT
FASLTDKNQINSIIAALSGTLESLHLEELTQGLFPSAQEDANFAKELSSV
VHGLKNLTTVVNKQMVKGAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAAAGCCCAAGAAAACAAAAAAGGCAGTTCAGTCTAAGGCAGC
TCCTGTAAAGCGCGTACCAGAAGAATCTCAAGAAGCTGCTATCCAGCAGT
TAGAACTTGCGGTATCTGATCTATATAAAGAGCTTCCCTTAGCTCAGACA
TTTGCCAGTCTTACTGACAAGAATCAGATTAATAGCATCATCGCGGCTCT
TTCTGGAACTCTAGAATCTTTACATCTCGAAGAGTTAACTCAAGGATTAT
TCCCTTCTGCCCAAGAAGATGCCAACTTCGCAAAGGAGTTATCTTCAGTA
GTACACGGATTAAAAAACCTAACCACTGTAGTTAATAAACAAATGGTTAA
AGGCGCTGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy