Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR646 IGR642 IGR644 IGR643 IGR641 IGR647 IGR640 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 mutL, - CPn0812 CPn0810 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 pepP, - CPn0813 mutL, - CPn0812 lcrH_1, - CPn0811 CPn0808 CPn0809 thrS, - CPn0806 CPn0810 CPn0807 pepP, - CPn0813 mutL, - CPn0812
* Calculated from Protein Sequence

Gene ID: CPn0809

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
917785

Gene Stop:
916304

Gene Length:
1482

Molecular Weight*:
50480

pI*:
10.20

Net Charge*:
13.22

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT578, a hypothetical protein sequence. Residues 1-487 are 53% similar to CT578.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 177-336 are 27% similar to a defined domain of Q56019_XXXXX, defined as: MEMBRANE ANTIGEN VIRULENCE TRANSMEMBRANE INNER PLASMID SIPB SPAT SIPC SIPD.

Paralogs:  Local Blast Search
CPn0809 is a possible paralog. Residues 4-446 are 23% similar to CPn0808.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
183
coil-coil  
186  
256
transmembrane  
258  
282
transmembrane  
287  
311
transmembrane  
326  
350
transmembrane  
388  
405
coil-coil  
407  
434
transmembrane  
471  
488

PDB Hit:


Gene Protein Sequence:
MSISSSSGPDNQKNIMSQVLTSTPQGVPQQDKLSGNETKQIQQTRQGKNT
EMESDATIAGASGKDKTSSTTKTETAPQQGVAAGKESSESQKAGADTGVS
GAAATTASNTATKIAMQTSIEEASKSMESTLESLQSLSAAQMKEVEAVVV
AALSGKSSGSAKLETPELPKPGVTPRSEVIEIGLALAKAIQTLGEATKSA
LSNYASTQAQADQTNKLGLEKQAIKIDKEREEYQEMKAAEQKSKDLEGTM
DTVNTVMIAVSVAITVISIVAAIFTCGAGLAGLAAGAAVGAAAAGGAAGA
AAATTVATQITVQAVVQAVKQAVITAVRQAITAAIKAAVKSGIKAFIKTL
VKAIAKAISKGISKVFAKGTQMIAKNFPKLSKVISSLTSKWVTVGVGVVV
AAPALGKGIMQMQLSEMQQNVAQFQKEVGKLQAAADMISMFTQFWQQASK
IASKQTGESNEMTQKATKLGAQILKAYAAISGAIAGAHKTNNF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTATTTCATCTTCTTCAGGACCTGACAATCAAAAAAATATCATGTC
TCAAGTTCTGACATCGACACCCCAGGGCGTGCCCCAACAAGATAAGCTGT
CTGGCAACGAAACGAAGCAAATACAGCAAACACGTCAGGGTAAAAACACT
GAGATGGAAAGCGATGCCACTATTGCTGGTGCTTCTGGAAAAGACAAAAC
TTCCTCGACTACAAAAACAGAAACAGCTCCACAACAGGGAGTTGCTGCTG
GGAAAGAATCCTCAGAAAGTCAAAAGGCAGGTGCTGATACTGGAGTATCA
GGAGCGGCTGCTACTACAGCATCAAATACTGCAACAAAAATTGCTATGCA
GACCTCTATTGAAGAGGCGAGCAAAAGTATGGAGTCTACCTTAGAGTCAC
TTCAAAGCCTCAGTGCCGCGCAAATGAAAGAAGTCGAAGCGGTTGTTGTT
GCTGCCCTCTCAGGGAAAAGTTCGGGTTCCGCAAAATTGGAAACACCTGA
GCTCCCCAAGCCCGGGGTGACACCAAGATCAGAGGTTATCGAAATCGGAC
TCGCGCTTGCTAAAGCAATTCAGACATTGGGAGAAGCCACAAAATCTGCC
TTATCTAACTATGCAAGTACACAAGCACAAGCAGACCAAACAAATAAACT
AGGTCTAGAAAAGCAAGCGATAAAAATCGATAAAGAACGAGAAGAATACC
AAGAGATGAAGGCTGCCGAACAGAAGTCTAAAGATCTCGAAGGAACAATG
GATACTGTCAATACTGTGATGATCGCGGTTTCTGTTGCCATTACAGTTAT
TTCTATTGTTGCTGCTATTTTTACATGCGGAGCTGGACTCGCTGGACTCG
CTGCGGGAGCTGCTGTAGGTGCAGCGGCAGCTGGAGGTGCAGCAGGAGCT
GCTGCCGCAACCACGGTAGCAACACAAATTACAGTTCAAGCTGTTGTCCA
AGCGGTGAAACAAGCTGTTATCACAGCTGTCAGACAAGCGATCACCGCGG
CTATAAAAGCGGCTGTCAAATCTGGAATAAAAGCATTTATCAAAACTTTA
GTCAAAGCGATTGCCAAAGCCATTTCTAAAGGAATCTCTAAGGTTTTCGC
TAAGGGAACTCAAATGATTGCGAAGAACTTCCCCAAGCTCTCGAAAGTCA
TCTCGTCTCTTACCAGTAAATGGGTCACGGTTGGGGTTGGGGTTGTAGTT
GCGGCGCCTGCTCTCGGTAAAGGGATTATGCAAATGCAGCTCTCGGAGAT
GCAACAAAACGTCGCTCAATTTCAGAAAGAAGTCGGAAAACTGCAGGCTG
CGGCTGATATGATTTCTATGTTCACTCAATTTTGGCAACAGGCAAGTAAA
ATTGCCTCAAAACAAACAGGCGAGTCTAATGAAATGACTCAAAAAGCTAC
CAAGCTGGGCGCTCAAATCCTTAAAGCGTATGCCGCAATCAGCGGAGCCA
TCGCTGGCGCACATAAAACCAATAATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy