Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR638 IGR642 IGR644 IGR639 IGR643 IGR641 IGR640 IGR645 CPn0810 lcrH_1, - CPn0811 CPn0804 minD, - CPn0805 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 mutL, - CPn0812 CPn0810 lcrH_1, - CPn0811 CPn0804 minD, - CPn0805 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 mutL, - CPn0812 lcrH_1, - CPn0811 minD, - CPn0805 CPn0808 CPn0809 thrS, - CPn0806 CPn0810 CPn0804 CPn0807 mutL, - CPn0812
* Calculated from Protein Sequence

Gene ID: CPn0808

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
916287

Gene Stop:
914953

Gene Length:
1335

Molecular Weight*:
44466

pI*:
10.20

Net Charge*:
8.21

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to two hypothetical protein sequences in C.trachomatis. Residues 1-444 are 54% similar to CT579; residues 4-442 are 22% similar to CT578.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 172-311 are 31% similar to a defined domain of P71214_ECOLI, defined as: ESPB EAEB PROTEIN CELL ADHESION AMINOTRANSFERASE PYRIDOXAL PHOSPHATE GENE.

Paralogs:  Local Blast Search
CPn0809,a hypothetical protein, is a possible paralog. Residues 3-417 are 22% similar to CPn0809.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
137
transmembrane  
138  
155
non-globular  
156  
206
transmembrane  
207  
224
non-globular  
225  
444

PDB Hit:


Gene Protein Sequence:
MTSGVSGSSSQDPTLAAQLAQSSQKAGNAQSGHDTKNVTKQGAQAEVAAG
GFEDLIQDASAQSTGKKEATSSTTKSSKGEKSEKSGKSKSSTSVASASET
ATAQAVQGPKGLRQNNYDSPSLPTPEAQTINGIVLKKGMGTLALLGLVMT
LMANAAGESWKASFQSQNQAIRSQVESAPAIGEAIKRQANHQASATEAQA
KQSLISGIVNIVGFTVSVGAGIFSAAKGATSALKSASFAKETGASAAGGA
ASKALTSASSSVQQTMASTAKAATTAASSAGSAATKAAANLTDDMAAAAS
KMASDGASKASGGLFGEVLNKPNWSEKVSRGMNVVKTQGARVASFAGNAL
SSSMQMSQLMHGLTAAVEGLSAGQTGIEVAHHQRLAGQAEAQAEVLKQMS
SVYGQQAGQAGQLQEQAMQSFNTALQTLQNIADSQTQTTSAIFN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATCAGGAGTTAGTGGAAGTTCAAGTCAGGATCCCACATTGGCTGC
GCAATTGGCACAATCCTCTCAAAAAGCAGGAAATGCTCAGAGCGGTCACG
ATACTAAGAATGTAACAAAGCAAGGGGCTCAAGCAGAAGTCGCTGCTGGA
GGCTTTGAGGATCTCATTCAAGACGCTTCAGCGCAAAGTACAGGAAAAAA
AGAAGCTACATCTTCAACTACTAAAAGTAGTAAGGGAGAAAAAAGCGAAA
AATCTGGGAAATCTAAATCCTCAACTTCGGTAGCAAGCGCAAGTGAAACT
GCAACGGCACAAGCCGTACAAGGTCCTAAGGGATTAAGACAAAATAATTA
TGACTCACCCAGCCTTCCTACTCCTGAGGCACAGACCATCAATGGTATTG
TACTTAAAAAAGGCATGGGTACGTTAGCACTCCTCGGTTTAGTTATGACC
TTGATGGCCAATGCTGCCGGAGAGTCTTGGAAAGCTTCATTCCAATCACA
AAACCAAGCGATCCGGTCACAAGTCGAATCCGCTCCTGCTATTGGAGAAG
CTATTAAAAGGCAAGCGAACCATCAAGCATCAGCTACAGAAGCACAGGCA
AAACAGTCCTTGATTAGTGGTATTGTAAACATTGTAGGATTTACAGTTTC
TGTAGGAGCGGGTATTTTCTCTGCTGCAAAAGGAGCTACCTCGGCTTTAA
AATCTGCTTCCTTTGCCAAAGAAACAGGTGCCTCAGCTGCTGGAGGTGCT
GCTTCCAAAGCTTTAACTTCTGCAAGTTCTTCTGTTCAACAGACTATGGC
TTCGACTGCCAAGGCGGCAACAACAGCAGCGAGTTCTGCGGGATCAGCAG
CCACCAAAGCTGCAGCGAACCTAACCGATGATATGGCCGCAGCAGCTTCA
AAAATGGCCTCTGATGGAGCTTCGAAAGCTTCAGGAGGACTCTTTGGCGA
AGTCTTAAATAAACCTAACTGGTCTGAAAAAGTCTCCAGAGGTATGAACG
TAGTGAAAACTCAGGGAGCGCGTGTTGCATCATTTGCAGGAAATGCTCTT
TCTTCCTCTATGCAAATGAGTCAATTAATGCATGGACTCACAGCGGCTGT
TGAAGGTCTTTCTGCGGGGCAGACAGGAATAGAAGTCGCCCATCATCAGC
GGTTAGCAGGACAAGCAGAGGCTCAAGCAGAAGTCTTGAAACAAATGTCT
TCGGTTTATGGTCAGCAAGCAGGACAAGCAGGACAATTACAAGAGCAAGC
TATGCAATCATTTAATACTGCCTTACAAACACTACAAAATATTGCGGACT
CTCAAACACAAACAACATCTGCTATCTTTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy