Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR642 IGR644 IGR639 IGR643 IGR641 IGR640 IGR645 CPn0810 CPn0803 lcrH_1, - CPn0811 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 mutL, - CPn0812 CPn0810 CPn0803 lcrH_1, - CPn0811 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 CPn0807 mutL, - CPn0812 lcrH_1, - CPn0811 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 CPn0810 CPn0803 CPn0807 mutL, - CPn0812
* Calculated from Protein Sequence

Gene ID: CPn0807

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
913971

Gene Stop:
914882

Gene Length:
912

Molecular Weight*:
33270

pI*:
9.80

Net Charge*:
8.23

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to conserved hypothetical protein sequences; e.g. residues 1-303 are 60% similar to CT580, a conserved hypothetical protein; residues 12-270 are 22% similar to (Z99107) similar to hypothetical proteins from B. subtilis [Bacillus subtilis]; residues 3-291 are 23% similar to (AF056092) unknown [Yersinia enterocolitica]; residues 3-262 are 23% similar to YTR1_BUCAP; and residues 1-116 are 25% similar to (AP000003) 285aa long hypothetical protein [Pyrococcus horikoshii].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0697
COG name: Predicted permeases
Functional Class:  R
The phylogenetic pattern of COG0697 is A-tKYQVCEB-Huj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 5-55 and 63-116 represent blocks BP03749A-B (CHLOROPLAST PRECURSOR TRANSLOCATOR TRANSIT PEP) with a combined E-value of 0.00085.

ProDom Summary:  Protein Domain Search
Residues 8-114 are 28% similar to a defined domain of Y976_HAEIN, defined as: HYPOTHETICAL PROTEIN HI0976. HYPOTHETICAL PROTEIN; TRANSMEMBRANE.
Residues 68-135 are 32% similar to a defined domain of YYAM_BACSU, defined as: PROTEIN INTERGENIC REGION TRANSMEMBRANE LONG CONSERVED 3'REGION GENE MEMBRANE ORF.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 135 (E-value = 9e-27) place CPn0807 in the DUF6 family which is described as Integral membrane protein DUF6 (PF00892)
Residues 163 to 292 (E-value = 2.8e-16) place CPn0807 in the DUF6 family which is described as Integral membrane protein DUF6 (PF00892)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
4  
22
transmembrane  
28  
52
transmembrane  
57  
81
transmembrane  
92  
109
transmembrane  
118  
135
transmembrane  
153  
170
transmembrane  
183  
200
transmembrane  
218  
235
transmembrane  
249  
266
transmembrane  
271  
288

PDB Hit:


Gene Protein Sequence:
MSLFLVFLTAFIWSSSFALSKLVMNASAPIFATGARMVIAGAILALAAWF
RGGFVGISKKIFLYIVLLALTGFYLTNIFEFIGLQSLSSSKTCFIYGLSP
LMSALFSYIQLKEKVTLKKVLGLSLGLVSYICYLTFGGGGDDSQPWTWQI
GLPELLILGAASLASFGWTLLRQIEKQSTLSVTAINAYAMLIAGMLSIMH
SAVVEPWRPLPVQDISQFLYATLALVVISNLICYNLYAKLLRKYSSTFLS
FCNLVMPLYSGFYGWILLGEKGVSLGLVLAVAFMVAGCRLIYHEEFRQGY
IVS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGCTTTTTCTAGTTTTTCTTACGGCATTTATTTGGTCTTCTTCCTT
CGCTCTTAGCAAACTAGTTATGAATGCTTCAGCTCCGATATTTGCTACAG
GAGCTCGCATGGTAATCGCTGGTGCGATCTTGGCTCTTGCTGCATGGTTT
CGAGGCGGTTTTGTTGGTATATCGAAGAAAATATTCTTATATATCGTCCT
GTTAGCTTTAACAGGTTTCTATCTTACCAATATTTTTGAGTTCATAGGAT
TACAAAGTCTAAGTTCATCTAAGACATGCTTTATTTATGGACTCTCTCCT
CTAATGTCAGCACTTTTTTCCTATATTCAGCTGAAAGAGAAAGTGACTCT
CAAAAAGGTTTTAGGATTATCCCTAGGCTTGGTGAGCTATATTTGTTACT
TAACCTTTGGTGGGGGAGGAGACGATTCTCAGCCTTGGACCTGGCAAATA
GGTCTTCCTGAGCTTCTAATCTTAGGGGCAGCAAGTTTAGCTTCTTTTGG
CTGGACTCTTCTTAGACAAATCGAAAAGCAGTCTACGTTATCGGTCACAG
CAATTAATGCATACGCGATGTTAATAGCCGGAATGCTATCAATCATGCAC
TCTGCAGTCGTGGAACCCTGGCGTCCTTTACCAGTGCAAGATATATCGCA
GTTTCTATACGCGACTTTGGCTCTAGTGGTAATTTCTAATTTGATTTGCT
ACAACCTGTACGCCAAATTATTAAGAAAGTATTCTTCCACTTTCCTTTCA
TTTTGTAACCTTGTCATGCCACTTTATTCAGGCTTTTATGGTTGGATATT
GCTTGGGGAGAAGGGAGTCTCCTTGGGCTTGGTGTTAGCTGTAGCCTTCA
TGGTGGCGGGCTGTCGTCTCATCTACCATGAAGAGTTCCGACAGGGCTAC
ATTGTTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy