Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR642 IGR639 IGR643 IGR641 IGR640 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0808 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0807
* Calculated from Protein Sequence

Gene ID: CPn0806

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thrS  

Definition:
threonyl-tRNA synthetase

Gene Start:
913771

Gene Stop:
911864

Gene Length:
1908

Molecular Weight*:
72676

pI*:
5.80

Net Charge*:
-14.86

EC:
6.1.1.3  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Threonyl-tRNA synthetase is believed to be a cytoplasmically located homodimer that belongs to class-II aminoacyl-tRNA synthetases.
ThrS is able to autoregulate its own translation by binding to its mRNA and repressing translation.

Reaction: ATP + l-threonine + tRNA(thr) = AMP + pyrophosphate + l-threonyl-tRNA(thr).


Blast Summary:  PSI-Blast Search
CPn0806 is orthologously related to CT581: residues 1-635 of CPn0806 are 75% similar to residues 26-660 of CT581, a predicted threonyl-tRNA synthetase from C. trachomatis.
CPn0806 is also similar to TP0837, UU534, MG375.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0441
COG name: Threonyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0441 is amtkYqVceBrhujgpoLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 58 (E-value = 4.5e-08) place CPn0806 in the TGS family which is described as TGS domain (PF02824)
Residues 256 to 409 (E-value = 2.3e-59) place CPn0806 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 535 to 625 (E-value = 6.4e-28) place CPn0806 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
549  
582

PDB Hit:


Gene Protein Sequence:
MIQVTCDQKNYEVLEGTTAAELAKQLKNSHQFIGVLINERPRDLSTHLNE
GDTLVFLTSEDPEGREIFLHTSAHLLAQAVLRLWPDAIPTIGPVIDHGFY
YDFANLSISESDFPLIEDTVKQIVDEKLAISRFTYGDKQQALAQFPQNPF
KTELIRELPENEEISAYSQGEFFDLCRGPHLPSTAHVKAFKVLRTSAAYW
RGDPSRESLVRIYGTSFPTSKELRAHLEQIEEAKKRDHRVLGAKLDLFSQ
QESSPGMPFFHPRGMIVWDALIRYWKQLHTAAGYKEILTPQLMNRQLWEV
SGHWDNYKANMYTLQIDDEDYAIKPMNCPGCMLYYKTRLHSYKEFPLRVA
EVGHVHRQEASGALSGLMRVRAFHQDDAHVFLTPEQVEEETLNILQLVST
LYGTFGLEYHLELSTRPEKDTIGDDSLWELATDALNRALVQSGTPFIVRP
GEGAFYGPKIDIHVKDAIQRTWQCGTIQLDMFLPERFELEYTTAQGTKSV
PVMLHRALFGSIERFLGILIENFKGRFPLWLSPEQVRIITVADRHIPRAK
ELEEAWKRLGLVVTLDDSSESVSKKIRNAQNMQVNYMITLGDHEINENVL
AVRTRDNRVINDVSVERFLNTILEEKNSLSLTALL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCAAGTAACTTGTGATCAAAAAAATTATGAAGTACTCGAAGGTAC
TACAGCAGCGGAACTCGCTAAACAATTAAAAAATTCTCATCAATTCATTG
GTGTTCTCATTAACGAACGCCCTAGAGATCTTTCCACCCACCTAAACGAA
GGCGACACCTTAGTATTTCTGACTTCCGAAGATCCCGAAGGACGAGAAAT
TTTTCTTCATACTTCTGCCCATCTTCTAGCCCAAGCCGTATTGCGTTTAT
GGCCTGATGCAATTCCTACAATCGGCCCTGTCATCGACCATGGCTTTTAC
TATGATTTTGCCAATCTTTCCATTAGCGAAAGTGATTTCCCGTTAATTGA
AGATACAGTAAAACAAATTGTTGATGAAAAGCTTGCGATTTCTCGCTTTA
CTTATGGCGATAAGCAACAAGCTTTAGCACAATTCCCACAGAATCCATTT
AAGACAGAGTTGATTCGTGAGCTTCCTGAAAATGAAGAAATTTCTGCCTA
TAGCCAAGGGGAGTTTTTTGATCTTTGCCGAGGTCCTCACCTTCCCTCTA
CAGCTCATGTAAAAGCGTTTAAAGTCTTACGCACATCTGCAGCTTATTGG
CGAGGGGATCCTTCTCGAGAATCTTTAGTACGTATTTACGGAACTTCGTT
TCCTACATCTAAGGAACTTCGAGCACATTTAGAGCAAATTGAGGAAGCAA
AAAAACGGGACCACCGTGTTTTGGGGGCCAAGTTAGATCTATTTTCTCAG
CAAGAAAGTTCTCCTGGAATGCCCTTCTTCCATCCTCGCGGTATGATTGT
TTGGGATGCATTGATTCGTTATTGGAAGCAGCTGCACACAGCTGCGGGTT
ATAAGGAAATCCTAACGCCACAGTTGATGAATCGTCAGTTATGGGAAGTT
TCAGGCCACTGGGACAATTATAAAGCAAACATGTACACACTGCAAATCGA
CGATGAAGATTATGCCATTAAGCCCATGAACTGCCCAGGATGCATGCTCT
ATTATAAAACCCGCTTGCATAGTTATAAGGAGTTCCCTCTACGTGTAGCA
GAAGTTGGTCATGTCCATCGTCAAGAAGCTTCGGGAGCCCTTTCAGGGTT
AATGCGTGTCCGTGCGTTCCACCAAGATGATGCTCATGTATTTCTTACTC
CAGAGCAAGTCGAAGAGGAAACTTTGAATATTCTTCAGTTAGTTTCTACA
CTGTACGGTACATTTGGATTAGAGTATCACCTGGAACTCTCCACACGTCC
AGAAAAAGATACGATTGGGGATGATTCTCTATGGGAGCTAGCAACAGATG
CCTTAAATCGAGCATTAGTTCAGTCCGGGACACCCTTCATTGTTCGTCCA
GGAGAAGGTGCTTTTTACGGTCCTAAAATTGATATCCATGTTAAAGATGC
GATTCAAAGAACATGGCAATGTGGAACCATCCAGTTAGACATGTTCCTTC
CAGAGCGTTTCGAATTAGAATACACCACAGCTCAAGGAACTAAGAGTGTT
CCTGTGATGTTACATCGGGCTCTTTTTGGTTCTATAGAACGCTTTTTAGG
AATTCTGATTGAGAACTTCAAAGGAAGATTCCCCTTATGGTTAAGTCCTG
AGCAAGTGCGTATCATCACAGTTGCTGATCGCCATATTCCTAGAGCGAAA
GAGCTCGAGGAAGCGTGGAAACGTTTAGGCTTAGTCGTCACCTTAGACGA
TTCTAGTGAGTCTGTAAGTAAAAAGATTCGCAATGCCCAAAACATGCAGG
TCAATTACATGATCACTCTTGGAGATCATGAAATTAATGAAAATGTACTC
GCAGTACGCACCCGAGATAACCGAGTGATTAATGATGTCTCTGTAGAGAG
ATTCTTAAACACTATACTTGAAGAAAAGAACTCTTTAAGTTTAACTGCAT
TATTGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy