Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR642 IGR639 IGR641 IGR634 IGR640 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0809 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0808 CPn0807
* Calculated from Protein Sequence

Gene ID: CPn0805

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
minD  

Definition:
SpoOJ regulator (chromosome partitioning ATPase)

Gene Start:
911831

Gene Stop:
911064

Gene Length:
768

Molecular Weight*:
28079

pI*:
6.30

Net Charge*:
-2.74

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-255 are 85% similar to CT582, a predicted SpoOJ regulator.
Residues 22-252 are 35% similar to pCT05, plasmid virulence factor PGP5-D (SOJ related).
Residues 2-249 are 32% similar to TP0272, a chromosome partitioning protein.
Residues 10-251 are 22% similar to MG470, a predicted SOJ protein (SpoOJ regulator).

COGS Summary:  COGS Search
BeTs to 12 clades of COG1192
COG name: ATPases involved in chromosome partitioning
Functional Class:  D
The phylogenetic pattern of COG1192 is -mtk-q-C-BR-UJgpOlinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 120-162 align to block DM01756B (1 kw MIND INHIBITOR DIVISION CONTROL) with an E-value of 9.5e-20.

ProDom Summary:  Protein Domain Search
Residues 116-237 are 38% similar and residues 1-51 are 62% to a defined domain of Q46277_XXXXX, defined as: PROTEIN NITROGENASE ATP-BINDING IRON-SULFUR REDUCTASE PLASMID 4FE-4S OXIDOREDUCTASE IRON II.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 83 to 194 (E-value = 2.6e-22) place CPn0805 in the ParA family which is described as ParA family ATPase (PF00991)

PDB Hit:


Gene Protein Sequence:
MKTIAVNSFKGGTAKTSTTLHLGAALAQYHQARVLLIDFDAQANLTSGLG
LDPDCYDSLAVVLQGEKEIQEVIRPIQDTQLDLIPADTWLERIEVSGNLA
ADRYSHERLKYVLGSVQDKYDYVIIDTPPSLCWLTESALIAADYALICAT
PEFYSVKGLERLAGFIQGISARHPLTILGVALSFWNCRGKNNSAFAELIH
KTFPGKLLNTKIRRDITVSEAAIHGKPVFATSPSARASEDYFNLTKELLI
LLRDI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGACCATCGCTGTAAACAGCTTTAAAGGTGGAACAGCAAAAACATC
AACAACCCTTCATCTTGGTGCGGCTCTTGCCCAGTACCATCAAGCCAGGG
TATTGCTTATTGATTTTGACGCTCAAGCAAATCTCACCTCTGGATTAGGC
TTAGATCCTGATTGCTATGACAGCCTTGCTGTTGTGTTACAAGGCGAAAA
AGAAATTCAAGAAGTCATCCGACCCATCCAAGACACTCAGCTGGATTTAA
TTCCTGCTGACACCTGGTTAGAGCGTATTGAAGTGTCAGGAAATCTTGCT
GCGGATCGCTATTCTCATGAAAGACTGAAATATGTACTTGGTTCTGTCCA
AGACAAGTACGACTATGTGATTATTGATACTCCTCCTTCACTTTGTTGGC
TTACAGAATCTGCCCTAATTGCTGCTGATTATGCGCTTATTTGCGCTACC
CCAGAATTTTATAGTGTCAAAGGTCTAGAACGTCTGGCTGGTTTCATCCA
AGGAATTTCAGCACGACATCCCCTAACGATTTTAGGAGTTGCCTTATCCT
TTTGGAATTGCAGAGGGAAAAACAATTCCGCATTTGCTGAGCTGATTCAC
AAAACTTTCCCCGGGAAGTTATTGAATACGAAAATACGTAGAGACATCAC
TGTTTCAGAAGCTGCGATTCATGGCAAACCTGTCTTTGCTACATCTCCCA
GTGCACGTGCCTCTGAAGATTATTTCAACCTCACTAAAGAATTGCTAATT
TTATTAAGAGATATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy