Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR639 IGR641 IGR634 IGR640 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0807
* Calculated from Protein Sequence

Gene ID: CPn0804

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
911059

Gene Stop:
910307

Gene Length:
753

Molecular Weight*:
29132

pI*:
10.30

Net Charge*:
13.08

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to Chlamydia proteins; e.g. residues 1-250 are 64% similar to CT583, a Chlamydia-specific conserved hypothetical protein sequence; residues 36-242 are 30% similar to pCT06, a plasmid virulence factor PGP6-D; and residues 12-190 are 32% similar to hypothetical protein 8 - Chlamydia psittaci.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-242 are 34% similar to a defined domain of Q46433_CHLTR, defined as: PROTEIN PLASMID VIRULENCE PGP6-D ORF6 P-10 NIGG II SEQUENCE DNA.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 249 (E-value = 1.2e-171) place CPn0804 in the UPF0137 family which is described as Uncharacterised protein family (UPF0137) (PF03677)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
223  
250

PDB Hit:


Gene Protein Sequence:
MGNLKTLLESRFKKNTPTKMEALARKRMEGDPSPLAVRLSNPTLSSKEKE
QLRHLLQHYNFREQIEEPDLTQLCTLSAEVKQIHHQSVLLHGERITKVRD
LLKSYREGAFSSWLLLTYGNRQTPYNFLVYYELFTLLPEPLKIEMEKMPR
QAVYTLASRQGPQEKKEEIIRNYRGERKSELLDRIRKEFPLVETDCRKTS
PVKQALAMLTKGSQILTKCTSLSSDEQIILEKLIKKLEKVKSNLFPDTKV
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGAATCTAAAAACGCTCTTAGAAAGTCGCTTCAAAAAGAATACTCC
CACTAAAATGGAAGCGCTTGCCCGTAAACGCATGGAAGGAGATCCCTCTC
CTCTTGCCGTTCGCCTTTCCAATCCTACGCTTTCCTCTAAAGAAAAAGAG
CAACTCCGTCATCTGCTTCAGCACTACAACTTTCGAGAACAGATTGAAGA
ACCTGATCTTACCCAGCTCTGTACTCTTTCTGCTGAAGTGAAGCAAATCC
ATCATCAATCTGTCCTTTTACATGGGGAGCGCATCACAAAAGTCCGTGAT
TTACTGAAAAGCTATCGTGAAGGTGCTTTTTCTTCTTGGCTTCTCTTAAC
CTATGGGAATAGACAAACCCCCTATAATTTTTTAGTTTACTACGAACTCT
TTACCCTTCTTCCTGAACCTTTAAAAATAGAGATGGAAAAGATGCCTAGA
CAAGCTGTCTATACTTTAGCATCTCGTCAAGGGCCCCAAGAAAAAAAAGA
AGAGATTATCCGAAACTACCGAGGGGAAAGAAAAAGCGAGCTTTTAGATC
GCATTCGCAAAGAGTTCCCCTTAGTTGAGACAGATTGTAGAAAAACATCA
CCAGTAAAGCAGGCTCTTGCTATGCTTACCAAAGGCTCTCAAATACTAAC
TAAGTGTACGAGTCTCTCTTCTGATGAGCAGATCATTTTGGAAAAATTGA
TAAAAAAACTAGAAAAAGTTAAAAGTAACCTCTTTCCCGATACAAAGGTA
TGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy