Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR639 IGR641 IGR634 IGR640 IGR633 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0804 minD, - CPn0805 trpS, - CPn0802 eno, - CPn0800 CPn0808 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0807
* Calculated from Protein Sequence

Gene ID: CPn0803

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
910303

Gene Stop:
909749

Gene Length:
555

Molecular Weight*:
21254

pI*:
5.70

Net Charge*:
-3.93

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT584, a hypothetical protein sequence. Residues 1-183 are 83% similar to CT584.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
142  
184

PDB Hit:


Gene Protein Sequence:
MAAKTKTLELEDNVFLLLEGNLKRIFATPIGYTTFREFQNVVFNCANGQQ
EIANFFFEMLINGKLTQELAPQQKQAAHSLIAEFMMPIRVAKDIHERGEF
INFITSDMLTQQERCIFLNRLARVDGQEFLLMTDVQNTCHLIRHLLARLL
EAQKNPVGEKNLQEIQEEITSLKNHFDELTKALQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCAAAGACAAAAACATTAGAGCTTGAAGACAATGTTTTTCTCCT
TCTTGAAGGAAATTTAAAAAGAATTTTTGCTACTCCTATTGGTTACACAA
CCTTTCGAGAATTTCAAAATGTCGTTTTCAACTGTGCCAATGGTCAGCAA
GAGATTGCAAATTTCTTTTTCGAGATGTTAATTAATGGCAAGTTAACACA
AGAACTTGCTCCTCAGCAAAAGCAAGCTGCGCATAGTTTAATTGCCGAAT
TTATGATGCCTATTCGTGTCGCTAAAGACATCCATGAACGCGGGGAATTT
ATTAATTTCATCACTTCAGATATGCTTACCCAACAAGAGCGTTGTATTTT
CTTAAATCGATTAGCTCGTGTCGATGGTCAAGAGTTCTTATTGATGACTG
ATGTGCAGAATACCTGCCACTTGATTCGTCATTTACTAGCAAGACTTTTA
GAAGCACAAAAGAATCCTGTTGGAGAGAAAAATCTTCAGGAAATTCAAGA
AGAAATTACATCATTAAAAAATCACTTTGATGAGCTAACTAAAGCACTTC
AATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy