Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR639 IGR634 IGR640 IGR633 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0807 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0807
* Calculated from Protein Sequence

Gene ID: CPn0802

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpS  

Definition:
tryptophanyl t-RNA synthetase

Gene Start:
909740

Gene Stop:
908706

Gene Length:
1035

Molecular Weight*:
39270

pI*:
7.40

Net Charge*:
1.82

EC:
6.1.1.2  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Tryptophanyl-tRNA synthetase is likely to be a cytoplasmically located homodimer
with similarity to class-I aminoacyl-tRNA synthetases.

Reaction: ATP + l-tryptophan + tRNA(trp) = AMP + pyrophosphate + l-tryptophanyl-tRNA(trp).

Blast Summary:  PSI-Blast Search
CPn0802 is orthologously related to CT585: residues 3-343 of CPn0802 are 77% similar to residues 2-342 of CT585, a predicted tryptophanyl t-RNA synthetase from C. trachomatis.
CPn0802 is also similar to TP0632, UU175, MG126.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0180
COG name: Tryptophanyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0180 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 291 (E-value = 6.2e-102) place CPn0802 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
93  
110
transmembrane  
132  
149

PDB Hit:


Gene Protein Sequence:
MNKKKRVLTGDRPTGKLHLGHWVGSIKNRLELQNSPEYDCFFIIADLHTL
TTKIRKEEVLDVDNHIYEVLADWLSVGIDPTKSIIYLQSAIPEIYELHLL
FSMLISINRVMGIPSLKDMARNASIEEGSLSYGLIGYPILQSADILLAKA
QFVPVGKDNEAHVELTRDIARNFNRLYGQVFPEPEVLQGELTSLVGIDGQ
GKMSKSANNAIYLSDSDATITEKVRKMYTDPNRIRATTPGRVEGNPLFIY
HDIFNPHKDEVEEFKARYRQGCIKDIEVKARLAEELIHFLKPIKERRSEF
LSKPLALQNVLEDGTHKMREVAKVTMEEVHDKFGFSHKWRSLLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAAAAAAGCGCGTACTTACCGGGGATCGTCCCACAGGGAAACT
CCATTTAGGGCATTGGGTTGGTTCTATAAAAAACCGATTAGAACTTCAAA
ATAGCCCTGAGTACGATTGCTTTTTTATTATTGCCGATCTCCACACCCTA
ACTACAAAAATCCGCAAGGAAGAGGTTTTAGATGTAGATAACCACATCTA
TGAAGTTCTTGCTGATTGGCTAAGTGTAGGGATTGATCCAACGAAATCTA
TAATTTACCTACAATCTGCGATCCCTGAGATCTACGAGTTACATCTCCTA
TTTTCGATGCTCATCTCAATCAATAGAGTGATGGGCATTCCCAGCCTCAA
AGATATGGCCCGAAATGCCTCAATCGAGGAGGGAAGTCTTTCTTATGGTC
TTATTGGGTACCCTATTTTACAAAGTGCGGATATTCTTCTAGCGAAAGCA
CAGTTTGTCCCTGTAGGGAAAGACAATGAAGCGCATGTGGAGCTCACCCG
GGATATCGCTAGAAATTTCAACCGTCTGTATGGGCAGGTATTTCCAGAGC
CCGAGGTACTACAAGGCGAGCTTACCTCTCTTGTAGGAATTGACGGGCAA
GGGAAAATGAGCAAGTCCGCGAACAACGCGATCTATCTTTCCGATAGCGA
CGCTACAATTACTGAGAAAGTCCGTAAGATGTACACGGATCCCAACCGGA
TTCGAGCAACCACACCAGGTCGAGTTGAAGGAAATCCCCTCTTTATTTAT
CATGACATCTTCAATCCCCATAAAGATGAGGTTGAAGAGTTTAAAGCACG
CTATCGTCAAGGTTGCATTAAAGACATCGAAGTAAAAGCACGCCTTGCTG
AAGAGCTGATTCACTTTTTAAAACCCATAAAAGAAAGACGCTCAGAATTT
CTATCCAAGCCTCTGGCATTACAAAACGTCTTAGAGGATGGCACGCATAA
AATGCGTGAAGTAGCCAAAGTCACTATGGAAGAAGTTCATGACAAATTTG
GGTTTAGCCATAAATGGCGCTCATTGCTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy