Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR638 IGR636 IGR635 IGR639 IGR632 IGR631 IGR634 IGR633 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0798 CPn0803 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0798 CPn0804 minD, - CPn0805 trpS, - CPn0802 CPn0799 eno, - CPn0800 thrS, - CPn0806 uvrB, - CPn0801 CPn0803 CPn0798
* Calculated from Protein Sequence

Gene ID: CPn0801

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uvrB  

Definition:
excinuclease ABC subunit B

Gene Start:
908697

Gene Stop:
906724

Gene Length:
1974

Molecular Weight*:
74822

pI*:
5.40

Net Charge*:
-13.31

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
The trimeric excinuclease ABC is responsible
for excising UV-damaged nucleotides.
CPn0096 is the A subunit and CPn0940 is the C
subunit

Blast Summary:  PSI-Blast Search
CPn0801 is similar to TP0116 in T. pallidum, UU120 in U. urealyticum and MG073 in M. genitalium. They are all predicted excinuclease ABC subunit B.

CPn0801 is orthologously related to CT586: residues 3-655 are 79% similar to residues 10-659 of CT586.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0556
COG name: Helicase subunit of the DNA excision repair complex
Functional Class:  L
The phylogenetic pattern of COG0556 is --t--qVcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 461 to 542 (E-value = 2.2e-20) place CPn0801 in the Helicase_C family which is described as Helicase conserved C-terminal domain (PF00271)
Residues 617 to 652 (E-value = 1.6e-09) place CPn0801 in the UVR family which is described as UvrB/uvrC motif (PF02151)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
613  
657

PDB Hit:


Gene Protein Sequence:
MTFQLHAPFAPCGDQPEAIARLSAGVRNQVKSQVLLGTTGSGKTFTIANV
VANVNLPTLVLAHNKTLAAQLYQEFREFFPNNAVEYFISYYDYYQPEAYI
ARSDTYIEKSLLINDEIDKLRLSATRSILERRDTLIVSSVSCIYGIGSPE
NYTSMALVLEVGKEYPRNILTAQLVKMHYQASPIPQRSAFRERGSVIDIF
PAYESELALRLEFLNDTLTSIEYSDPLTMIPKESVPSATLYPGSHYVIPE
AIREQAIRTIQEELEERMAFFDDRPIEKDRIFHRTTHDIEMIKEIGFCKG
IENYSRHFTGAPPGAPPTCLLDYFPEDFLLIIDESHQTLPQIRAMYRGDQ
SRKQSLVEYGFRLPSAFDNRPLTYEEAQKYFRKVIYVSATPGDTEVQESS
GHIVQQIIRPTGIPDPMPEIRPATGQVDDLLEEIRLRLSQKHEKILVISI
TKKLAEDMAGFLSELEIPAAYLHSGIETAERTQILTDLRSGVIDVLIGVN
LLREGLDLPEVSLVAILDADKEGFLRSTSSLIQFCGRAARNINGKVIFYA
DQKTRSIEETLRETERRRQIQLDYNKEHNIVPKPIIKAIFANPILQTSKD
SESPKESQRPLSKEDLEEQIKKYEALMQRAAKEFRFNEAAKYRDAMQACK
EQLLYLF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATTCCAACTTCATGCTCCTTTTGCTCCTTGCGGCGACCAGCCAGA
GGCGATTGCTCGGCTGTCTGCGGGTGTGCGTAATCAGGTAAAATCACAAG
TACTTCTTGGAACTACAGGTTCTGGGAAGACATTCACTATTGCGAATGTT
GTTGCCAACGTAAATCTCCCTACCCTGGTTTTAGCCCATAACAAAACGCT
AGCTGCTCAGCTGTATCAAGAATTTCGTGAATTTTTCCCTAATAATGCCG
TTGAGTATTTCATCTCTTACTACGATTACTATCAACCTGAGGCCTATATT
GCCCGTAGTGATACCTATATAGAAAAAAGCCTCCTTATCAATGATGAAAT
CGATAAGTTACGTTTATCAGCAACACGGTCTATTTTAGAGCGCCGAGACA
CTTTAATCGTTTCCTCAGTATCTTGCATTTATGGTATTGGTTCTCCTGAA
AACTATACATCCATGGCGTTAGTCTTAGAGGTAGGGAAAGAGTACCCTAG
GAATATCCTGACAGCTCAGCTTGTTAAAATGCACTATCAAGCATCTCCCA
TCCCACAGAGAAGTGCATTTCGAGAGCGTGGGAGTGTAATCGATATTTTC
CCTGCATACGAAAGTGAACTTGCCCTAAGATTAGAATTTCTAAATGACAC
CCTTACCTCCATAGAATACAGCGATCCCCTCACTATGATTCCCAAGGAAA
GTGTCCCTTCGGCTACTTTATATCCTGGATCTCATTACGTCATTCCTGAG
GCAATTCGCGAGCAAGCGATCCGAACCATTCAGGAAGAGTTAGAAGAGCG
CATGGCCTTTTTTGACGACCGTCCTATAGAAAAGGACCGCATTTTCCATC
GTACGACTCATGACATTGAGATGATCAAGGAAATCGGATTCTGCAAGGGC
ATAGAAAACTATTCACGGCATTTTACAGGGGCGCCCCCAGGAGCACCGCC
TACGTGCCTCTTAGATTATTTTCCTGAGGACTTTCTCCTTATTATCGATG
AGTCTCATCAAACACTACCTCAAATACGTGCTATGTATCGTGGAGACCAA
TCTCGGAAGCAATCTTTAGTAGAATATGGATTCCGTCTCCCCTCAGCCTT
CGATAACCGCCCGCTAACCTATGAAGAAGCCCAGAAGTACTTTCGTAAAG
TCATCTATGTCTCTGCAACACCAGGTGATACGGAAGTCCAAGAGAGCTCA
GGTCATATTGTACAACAAATCATCCGCCCGACGGGGATCCCCGATCCTAT
GCCTGAAATCCGTCCTGCTACAGGACAAGTGGATGATCTTCTTGAAGAAA
TTCGTTTGCGGCTGTCTCAGAAACATGAAAAAATCCTAGTGATTTCTATA
ACAAAGAAACTTGCCGAAGATATGGCGGGTTTTCTTTCAGAATTAGAGAT
CCCTGCGGCATACTTGCATTCTGGAATAGAAACTGCAGAACGCACGCAAA
TCCTTACAGACCTACGCTCGGGCGTTATTGACGTATTGATTGGAGTCAAT
CTCCTACGTGAAGGACTCGATCTTCCCGAGGTCTCTTTAGTTGCGATCTT
AGATGCTGACAAAGAGGGCTTTTTAAGAAGCACGTCATCTCTGATTCAGT
TTTGTGGAAGAGCTGCTAGGAATATCAATGGTAAAGTCATTTTCTATGCT
GATCAAAAAACCCGTTCTATAGAGGAGACTCTTCGAGAGACCGAACGCCG
GCGTCAGATACAGTTAGATTACAATAAAGAGCACAATATTGTTCCTAAGC
CCATTATAAAAGCTATTTTTGCCAATCCTATTCTACAAACCTCTAAAGAC
TCGGAGTCTCCCAAGGAATCTCAACGCCCCCTATCTAAAGAAGATCTTGA
AGAGCAAATTAAGAAATACGAAGCTCTCATGCAACGTGCTGCTAAAGAAT
TTCGATTCAACGAAGCTGCGAAATACCGCGATGCAATGCAAGCTTGCAAA
GAACAGCTTCTCTATTTGTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy