Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR637 IGR636 IGR635 IGR632 IGR631 IGR634 IGR630 IGR633 CPn0803 CPn0804 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0797 CPn0796 CPn0803 CPn0804 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0797 CPn0796 CPn0804 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0803 CPn0798 CPn0797 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0800

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
eno  

Definition:
enolase (phosphopyruvate hydratase)(2-phosphoglycerate dehydratase)

Gene Start:
906532

Gene Stop:
905246

Gene Length:
1287

Molecular Weight*:
46093

pI*:
4.50

Net Charge*:
-24.55

EC:
4.2.1.11  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosineand tryptophan biosynthesis Carbohydrate Metabolism; Glycolysis /Gluconeogenesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0800 is similar to TP0817 in T. pallidum,
MG407 in M. pallidum and UU184 in U. urealyticum.

CPn0800 is orthologously related to CT587, a predicted enolase.
Residues 1-422 are 73% similar to CT587.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0148
COG name: Enolase
Functional Class:  G
The phylogenetic pattern of COG0148 is aMtKYqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 136 (E-value = 2.3e-53) place CPn0800 in the Enolase_N family which is described as Enolase, N-terminal domain (PF03952)
Residues 141 to 424 (E-value = 4.3e-151) place CPn0800 in the Enolase_C family which is described as Enolase, C-terminal TIM barrel domain (PF00113)

PDB Hit:


Gene Protein Sequence:
MFEAVIADIQAREILDSRGYPTLHVKVTTSTGSVGEARVPSGASTGKKEA
LEFRDTDSPRYQGKGVLQAVKNVKEILFPLVKGCSVYEQSLIDSLMMDSD
GSPNKETLGANAILGVSLATAHAAAATLRRPLYRYLGGCFACSLPCPMMN
LINGGMHADNGLEFQEFMIRPIGASSIKEAVNMGADVFHTLKKLLHERGL
STGVGDEGGFAPNLASNEEALELLLLAIEKAGFTPGKDISLALDCAASSF
YNVKTGTYDGRHYEEQIAILSNLCDRYPIDSIEDGLAEEDYDGWALLTEV
LGEKVQIVGDDLFVTNPELILEGISNGLANSVLIKPNQIGTLTETVYAIK
LAQMAGYTTIISHRSGETTDTTIADLAVAFNAGQIKTGSLSRSERVAKYN
RLMEIEEELGSEAIFTDSNVFSYEDSEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGAAGCTGTCATTGCCGATATCCAGGCTAGGGAAATCTTGGATTC
TCGCGGGTATCCCACTTTACATGTTAAAGTAACCACTAGCACAGGTTCTG
TTGGAGAAGCTCGGGTTCCTTCAGGAGCATCCACAGGGAAAAAAGAAGCC
TTAGAGTTTCGTGATACAGATTCTCCTCGTTATCAAGGCAAAGGGGTTTT
GCAAGCTGTAAAAAACGTAAAAGAAATTCTTTTTCCCCTCGTCAAGGGAT
GTAGTGTTTATGAGCAATCCTTAATTGATTCTCTGATGATGGATTCTGAC
GGCTCTCCGAACAAAGAAACTCTAGGGGCCAATGCTATTTTAGGAGTCTC
TCTAGCTACAGCACATGCAGCAGCAGCAACACTACGCAGACCTCTGTATC
GTTATTTAGGAGGGTGTTTTGCCTGCAGTCTTCCCTGTCCTATGATGAAT
CTGATCAATGGAGGCATGCATGCCGATAACGGCTTGGAGTTCCAAGAATT
TATGATCCGTCCTATTGGAGCCTCTTCCATCAAAGAAGCTGTCAACATGG
GTGCTGACGTTTTTCATACTTTGAAAAAATTACTCCATGAAAGAGGCTTA
TCTACTGGAGTGGGTGACGAAGGAGGCTTCGCCCCGAATCTTGCTTCTAA
TGAAGAAGCTCTAGAGCTCCTATTGCTGGCTATTGAAAAAGCAGGCTTTA
CTCCAGGAAAAGATATATCGCTAGCCTTAGACTGCGCAGCATCCTCATTC
TATAACGTAAAAACAGGCACGTATGATGGGAGGCACTATGAAGAGCAAAT
CGCAATCCTTTCTAATTTATGTGATCGCTATCCTATAGACTCCATAGAAG
ATGGTCTTGCTGAAGAAGACTATGACGGGTGGGCCTTGTTAACTGAAGTT
CTTGGAGAAAAAGTACAGATTGTGGGTGATGACCTATTTGTTACAAATCC
GGAATTAATATTAGAGGGTATTAGCAATGGATTAGCGAACTCTGTGTTGA
TTAAACCAAATCAGATAGGGACGCTTACTGAAACAGTGTATGCTATCAAG
CTTGCGCAAATGGCTGGCTATACTACAATTATTTCTCATCGCTCAGGAGA
AACTACGGACACTACGATTGCAGATCTTGCTGTTGCCTTCAACGCCGGTC
AAATCAAAACAGGCTCTTTATCACGTTCTGAGCGTGTTGCAAAATACAAT
AGACTCATGGAAATTGAAGAAGAGCTTGGATCCGAAGCAATTTTCACAGA
TTCTAATGTATTTTCTTACGAGGATTCTGAGGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy