Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR635 IGR632 IGR631 IGR634 IGR630 IGR633 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0797 CPn0796 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0797 CPn0796 trpS, - CPn0802 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0797 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0799

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
904986

Gene Stop:
903937

Gene Length:
1050

Molecular Weight*:
37225

pI*:
9.90

Net Charge*:
9.54

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hits to sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 12-345 are 37% similar to residues 11-347 of CPn0797.
Residues 6-345 are 36% similar to residues 37-360 of CPn0796.
Residues 68-345 are 40% similar to residues 45-320 of CPn0798.
Residues 157-322 are 34% similar to residues 99-277 of CPn0794.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MAAIKQILRSMLSQSSLWMVLFSLYSLSGYCYVITDKPEDDFHSSSAVKW
DHWGKTTLSRLSNKKASAKAVSGTGATTVGFIKDTWSRTYAVRWNYWGTK
ELPTSSWVKKSKATGISSDGSIIAGIVENELSQSFAVTWKNNEMYLLPST
WAVQSKAYGISSDGSVIVGSAKDAWSRTFAVKWTGHEAQVLPVGWAVKSV
ANSVSANGSIIVGSVQDASGILYAVKWEGNTITHLGTLGGYSAIAKAVSN
NGKVIVGRSETYYGEVHAFCHKNGVMSDLGTLGGSYSAAKGVSATGKVIV
GMSTTANGKLHAFKYVGGRMIDLGEYSWKEACANAVSIDGEIIVGVQSE$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCTATAAAACAAATTTTACGTTCTATGCTATCTCAGAGTAGCTT
ATGGATGGTCCTATTTTCATTATATTCTCTATCTGGTTATTGCTATGTAA
TTACAGACAAACCAGAAGATGACTTCCATTCTTCATCCGCAGTAAAATGG
GATCATTGGGGAAAGACAACTCTCTCAAGATTATCAAATAAAAAAGCCTC
TGCAAAAGCTGTTTCAGGAACTGGTGCTACAACTGTCGGCTTTATAAAAG
ACACTTGGTCTCGAACATACGCAGTAAGATGGAATTATTGGGGGACCAAA
GAACTCCCTACCAGCTCATGGGTAAAAAAATCAAAAGCAACAGGAATCTC
CTCTGATGGGTCTATAATCGCGGGGATTGTCGAGAATGAGCTTTCTCAAA
GTTTCGCAGTCACATGGAAAAACAATGAAATGTATTTGCTCCCTTCCACA
TGGGCAGTGCAATCTAAAGCGTATGGAATTTCTTCTGATGGCTCTGTTAT
TGTAGGGAGTGCTAAGGATGCTTGGTCGCGAACTTTCGCTGTGAAGTGGA
CGGGACACGAGGCTCAGGTGTTACCAGTAGGCTGGGCTGTCAAATCTGTA
GCGAATTCTGTATCTGCCAATGGATCTATAATTGTAGGGTCTGTACAAGA
CGCCTCTGGAATTCTTTATGCTGTAAAGTGGGAAGGGAACACTATTACAC
ATCTAGGAACTTTAGGAGGCTATTCTGCCATTGCAAAAGCTGTATCCAAT
AATGGCAAGGTCATTGTAGGGAGATCCGAAACATATTATGGAGAGGTCCA
TGCTTTCTGTCATAAGAATGGCGTCATGTCAGACCTCGGCACCCTCGGAG
GATCTTATTCTGCAGCTAAGGGAGTCTCTGCAACTGGAAAAGTTATTGTC
GGTATGTCCACAACAGCAAATGGGAAATTGCATGCCTTTAAATATGTCGG
TGGAAGAATGATCGACTTAGGAGAGTATAGCTGGAAAGAAGCCTGTGCAA
ACGCTGTTTCTATTGATGGAGAAATTATTGTTGGAGTCCAATCAGAATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy