Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR632 IGR629 IGR631 IGR634 IGR630 IGR633 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0795 CPn0797 CPn0796 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0795 CPn0797 CPn0796 CPn0799 eno, - CPn0800 uvrB, - CPn0801 CPn0798 CPn0795 CPn0797 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0798

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
902846

Gene Stop:
903859

Gene Length:
1014

Molecular Weight*:
36114

pI*:
4.60

Net Charge*:
-18.34

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hits to sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical sequences in C.pneumoniae:

Residues 18-333 are 40% similar to residues 50-373 of CPn0796.
Residues 42-334 are 36% similar to residues 63-361 of CPn0797.
Residues 45-320 are 40% similar to residues 68-345 of CPn0799.
Residues 114-337 are 29% similar to residues 37-273 of CPn0794.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
30

PDB Hit:


Gene Protein Sequence:
MKKTCCQNYRSIGVVFSVVLFVLTTQTLFAGHFIDIGTSGLYSWARGVSG
DGRVVVGYEGGNAFKYVDGEKFLLEGLVPRSEALVFKASYDGSVIIGISD
QDPSCRAVKWVNGALVDLGIFSEGMQSFAEGVSSDGKTIVGCLYSDDTET
NFAVKWDETGMVVLPNLPEDRHSCAWDASEDGSVIVGDAMGSEEIAKAVY
WKDGEQHLLSNIPGAKRSSAHAVSKDGSFIVGEFISEENEVHAFVYHNGV
IKDIGTLGGDYSVATGVSRDGKVIVGHSTRTDGEYRAFKYVDGRMIDLGT
LGGSASFAFGVSDDGKTIVGKFETELGECHAFIYLDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGACATGTTGCCAAAATTACAGATCGATAGGCGTTGTGTTCTC
TGTGGTACTTTTCGTTCTTACAACACAGACGCTGTTTGCAGGACATTTTA
TTGATATTGGAACTTCTGGATTATATTCTTGGGCTCGAGGTGTATCTGGA
GATGGCCGCGTTGTCGTAGGTTATGAAGGTGGCAATGCATTTAAATATGT
TGATGGTGAGAAATTTCTGTTAGAAGGTTTGGTCCCGAGATCCGAGGCCT
TGGTATTTAAAGCTTCTTATGATGGCTCTGTAATTATAGGAATCTCGGAT
CAAGATCCGTCTTGCCGCGCTGTGAAGTGGGTAAACGGTGCACTTGTTGA
TCTTGGAATATTTTCTGAGGGAATGCAATCTTTTGCAGAGGGTGTTTCCA
GTGATGGAAAGACGATTGTAGGGTGCCTATATAGTGATGATACAGAGACA
AACTTTGCTGTGAAGTGGGATGAAACAGGAATGGTTGTTCTCCCTAACTT
ACCAGAAGATCGACATTCTTGCGCTTGGGATGCCTCTGAAGATGGCTCTG
TGATTGTAGGGGACGCCATGGGTAGCGAGGAAATTGCCAAGGCAGTGTAC
TGGAAGGACGGTGAACAACATCTGCTTTCTAATATCCCAGGAGCTAAAAG
ATCGTCAGCACATGCAGTTTCTAAAGATGGATCTTTTATCGTAGGCGAGT
TCATCAGTGAAGAAAATGAAGTTCATGCCTTTGTTTATCACAACGGTGTT
ATCAAAGATATCGGGACTTTAGGAGGAGATTACTCTGTAGCAACTGGAGT
TTCTAGGGATGGTAAGGTCATCGTGGGTCATTCTACAAGAACAGATGGTG
AATACCGTGCATTTAAATATGTGGATGGAAGAATGATAGATTTGGGGACT
TTAGGAGGTTCAGCATCTTTTGCTTTTGGTGTTTCTGACGATGGCAAAAC
AATCGTAGGAAAATTTGAAACAGAGCTAGGAGAATGTCATGCCTTTATCT
ACCTTGATGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy