Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR629 IGR628 IGR631 IGR630 IGR627 rsbU, - CPn0793 CPn0794 CPn0798 CPn0795 CPn0797 CPn0796 rsbU, - CPn0793 CPn0794 CPn0798 CPn0795 CPn0797 CPn0796 rsbU, - CPn0793 CPn0792 CPn0792 CPn0794 CPn0798 CPn0795 CPn0797 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0795

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
898128

Gene Stop:
899198

Gene Length:
1071

Molecular Weight*:
39560

pI*:
7.50

Net Charge*:
2.33

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hits to sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Few significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 1-356 are 32% similar to residues 335-680 of CPn0796.
Residues 1-38 are 63% similar to residues 276-313 of CPn0799.
Residues 1-38 are 57% similar ro residues 251-288 of CPn0798.
Residues 1-39 are 48% similar to residues 97-135 of CPn0797.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKDLGTLGGTSSTAKTVSPDGKVIMGRSQIADGSWHAFMCHTDFSSNNVL
FDLDNTYKTLRENGRQLNSIFNLQNMMLQRASDHEFTEFGRSNIALGAGL
YVNALQNLPSNLAAQYFGIAYKIRPKYRLGVFLDHNFSSHVPNNFNVSHN
RLWMGAFIGWQDSDALGSSVKVSFGYGKQKATITREQLENTEAGSGESHF
EGVAAQIEGRYGKSLGGHVRVQPFLGLQFVHITRKEYTENAVQFPVHYDP
IDYSTGVVYLGIGSHIALVDSLHVGTRMGMEQNFAAHTDRFSGSIASIGN
FVFEKLDVTHTRAFAEMRVNYELPYLQSLNLILRVNQQPLQGVMGFSSDL
RYALGF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGATTTGGGGACTCTTGGGGGTACCTCTTCTACAGCAAAAACAGT
GTCCCCAGATGGTAAAGTGATCATGGGTAGATCACAAATTGCTGATGGCA
GTTGGCACGCATTTATGTGTCATACGGATTTCTCCTCTAATAATGTACTC
TTTGATCTCGATAATACGTATAAAACTCTAAGAGAAAATGGCCGTCAGCT
AAATTCCATATTCAACCTACAAAATATGATGTTACAGAGAGCCTCAGATC
ATGAGTTCACAGAGTTTGGAAGGAGTAACATCGCTCTTGGTGCCGGGCTT
TATGTGAATGCCTTGCAGAATCTCCCTAGCAATTTAGCAGCACAATATTT
TGGAATCGCATACAAAATACGTCCTAAATATCGTTTGGGGGTGTTTTTGG
ACCATAATTTCAGCTCCCACGTTCCTAATAATTTTAACGTAAGCCACAAT
AGACTCTGGATGGGAGCCTTTATTGGATGGCAGGATTCTGATGCTCTAGG
ATCTAGTGTCAAGGTGTCTTTCGGATATGGAAAACAAAAAGCCACGATTA
CAAGAGAGCAATTAGAGAATACAGAAGCCGGGAGTGGGGAGAGCCATTTT
GAAGGGGTCGCTGCTCAGATAGAAGGGCGGTATGGTAAGAGCCTCGGAGG
ACATGTCAGGGTCCAGCCTTTCCTAGGACTGCAGTTTGTCCACATTACAA
GGAAAGAATATACCGAAAATGCAGTGCAATTTCCTGTACACTATGATCCT
ATAGACTATTCTACAGGTGTAGTGTATTTAGGAATTGGATCTCATATTGC
ACTTGTAGATTCTTTACATGTAGGCACACGCATGGGAATGGAGCAAAACT
TTGCAGCCCATACGGACAGGTTCTCAGGATCTATAGCGTCTATTGGAAAC
TTTGTGTTTGAAAAGCTTGATGTGACTCACACAAGGGCATTTGCGGAAAT
GCGTGTCAACTATGAGCTTCCCTATCTACAGTCTCTGAATCTTATTCTAC
GAGTTAATCAACAGCCTCTACAAGGGGTTATGGGATTTTCCAGTGATCTT
AGGTATGCCTTAGGATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy