Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR626 IGR629 IGR628 IGR630 IGR627 rsbU, - CPn0793 CPn0791 CPn0794 CPn0795 CPn0797 CPn0796 rsbU, - CPn0793 CPn0791 CPn0794 CPn0795 CPn0797 CPn0796 rsbU, - CPn0793 CPn0792 CPn0792 CPn0791 CPn0794 CPn0795 CPn0797 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0794

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
897174

Gene Stop:
898007

Gene Length:
834

Molecular Weight*:
29165

pI*:
4.70

Net Charge*:
-5.67

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST to sequences outside of C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 22-277 are 32% similar to residues 52-293 of CPn0796.
Residues 52-277 are 33% similar to residues 69-280 of CPn0797.
Residues 99-277 are 34% similar to residues 157-322 of CPn0799.
Residues 37-273 are 29% similar to residues 114-337 of CPn0798.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
35
non-globular  
81  
148
non-globular  
191  
277

PDB Hit:


Gene Protein Sequence:
VSLYQKWWNSQLKKSLCYSTVAALIFMIPSQESFADSLIDLNLGLDPSVE
CLSGDGAFSVGYFTKAGSTPVEYQPFKYDVSKKTFTILSVETANQSGYAY
GISYDGTITVGTCSLGAGKYNGAKWSADGTLTPLTGITGGTSHTEARAIS
KDTQVIEGFSYDASGQPKAVQWASGATTVTQLADISGGSRSSYAYAISDD
GTIIVGSMESTITRKTTAVKWVNNVPTYLGTLGGDASTGLYISGDGTVIV
GAANTATVTNGNQESHAYMYKDNQMKD$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGTCTATATCAAAAATGGTGGAACAGTCAGTTAAAGAAGAGCCTCTG
CTATTCGACTGTTGCTGCTCTAATATTTATGATTCCTTCTCAAGAATCCT
TTGCAGATAGTCTTATAGATTTAAATTTAGGTTTAGATCCTTCGGTCGAA
TGTCTGTCAGGAGATGGTGCATTTTCTGTTGGGTATTTTACTAAGGCGGG
ATCGACTCCCGTAGAATATCAGCCGTTTAAATACGACGTATCTAAGAAGA
CATTCACAATCCTTTCCGTAGAAACGGCAAATCAGAGCGGCTATGCTTAC
GGAATCTCCTACGATGGCACGATCACTGTAGGAACGTGTAGCCTAGGTGC
AGGAAAATATAACGGCGCAAAATGGAGTGCGGATGGCACTTTAACACCCT
TAACTGGAATCACGGGGGGGACGTCACATACGGAAGCGCGTGCGATTTCT
AAGGATACTCAGGTGATCGAGGGTTTCTCATATGATGCTTCAGGGCAACC
CAAGGCTGTGCAGTGGGCAAGCGGAGCGACTACAGTAACACAATTAGCAG
ATATTTCAGGAGGCTCTAGAAGCTCTTATGCGTATGCTATATCTGATGAT
GGCACGATTATTGTTGGGTCTATGGAGAGCACGATAACAAGGAAAACTAC
AGCTGTAAAATGGGTAAATAATGTTCCTACGTATCTGGGAACCTTAGGAG
GAGATGCTTCTACAGGTCTTTATATTTCTGGAGACGGCACCGTGATTGTA
GGTGCGGCAAATACAGCAACTGTAACCAATGGGAATCAGGAATCCCACGC
CTATATGTATAAAGATAACCAAATGAAAGATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy